KEGG   Meyerozyma guilliermondii: PGUG_00455Help
Entry
PGUG_00455        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PGUG_00455
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PGUG_00455
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PGUG_00455
Lipid biosynthesis proteins [BR:pgu01004]
 Desaturase
  First
   PGUG_00455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 524 aa AA seqDB search
MVVVEAEWTPDKIPARVQRRKPALGGEKISSSQNLSHIFNQASHIKNARMNLMRRRKRDF
LTRINYTNTFTVAVLPALALVYVFFYAKSLLPENSATFKFSFIYYHVMLLAFSAGYHKCF
AHNTYRVKYGVLLWYFAIFGAGIGLGSIRWWATLHRAHHQYTDDTERDPYLIKRGFAWAH
YGWLIRKPKIVQFYEDFVQHEFPDEQSVIQNEIDDNNEDDFFDEIDSEKRAYQEQMRLVV
LQQERLYLVFWFISTIVIPVLVTVTICNDTVINGLLYPGILRMFISQQPILLTQSVCHLK
HIQATIPTQPFNDKNSSQNCNNPLMAFLTYGNAAQNYHHEFPHDYRSQSSHLAYDPTKWF
IWILSKIGMVDELCKTPKDLITQLQIQQQQRVINRMKSQLNWGTPISKLPLITPKQFKDI
LASASHSGRIYIIIQKVIHDITPFMNQHPGGIQLLKASHGLDATKAFYGGVYGHLTAAVN
LLATMRIGLLDDGNDEDVWRRVAKEQREVNDDHQSKLYKSAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggttgtggtagaagcagagtggactcctgataaaattccggcgagggtccaacggcgc
aagccagctctgggcggcgagaagatatcatcgtctcaaaatctgagccacattttcaac
caggcctcacatataaagaatgcccgaatgaacctgatgcggaggcgaaagcgggacttt
ttaacccgaataaactatacgaatacatttactgtggctgtcttgccggcattggcattg
gtgtatgttttcttctatgccaaatcacttttacctgaaaattctgccactttcaagttc
tctttcatctactatcatgtgatgctattggcattttccgctggatatcacaaatgcttt
gcccataatacctatagagtcaagtacggggtacttctgtggtattttgctatttttggg
gctggaattggccttggttccattcgttggtgggctactttacatcgggctcaccaccaa
tataccgatgataccgagcgtgatccatacctgatcaagagaggtttcgcctgggcacat
tatgggtggctaataagaaaaccaaaaattgttcaattttatgaagattttgtgcagcat
gaatttcctgatgagcagagcgtgattcagaatgaaatcgacgacaacaacgaagatgac
ttttttgatgagattgattcagagaagagagcttaccaagaacagatgagactggttgtg
ttgcagcaggaaagactctatcttgttttttggttcattagtaccattgtcatacctgtt
ctcgtcacagttaccatatgcaacgatactgtgatcaatggccttttgtaccctggcatt
cttcggatgttcatttctcagcagcccattcttctcacgcagtctgtctgtcaccttaaa
catattcaagcaacaattcctacccagccattcaatgataagaattcatcgcaaaattgc
aataatcctcttatggcattccttacttatggaaacgcagcacagaactatcatcatgag
tttccccacgactaccgttcacaatcgtcacacctagcttatgatcccaccaagtggttc
atatggatattgagcaaaatcggtatggttgacgaactctgtaaaaccccaaaagatctc
attacacagcttcaaatccagcaacaacagcgagtaattaatagaatgaagagccagctc
aattggggcacaccaatctccaagcttcctctcattactcccaaacagttcaaggacata
cttgcttctgccagtcacagtggccgcatttacatcattattcaaaaagtgatacacgat
atcacccccttcatgaaccagcatcccggcggaattcagttgttgaaagcgtcccatggc
ttagatgctaccaaggcattctacggtggagtctacggacatctgacggctgctgtcaac
ctcttggctacgatgagaatcgggcttttggatgatggaaatgacgaagatgtgtggaga
agagtagccaaggagcaacgagaagtaaatgatgaccaccagagtaaactgtataaatca
gctgaggcggcctaa

DBGET integrated database retrieval system