KEGG   Meyerozyma guilliermondii: PGUG_00492Help
Entry
PGUG_00492        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pgu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 879 aa AA seqDB search
MTSEVARLRNDEELRQVATKMAQKLLFHTKKLSSLLSYVISLLEVFKKEIQRNSKLGYCD
YELAFVCYQAAGVLCKECEKQDKNSDLVKATRDTYNLKNNDYATISAVLEVSDNHPQKNV
GNGLDLEADLLARFQNLKSLSSDSFATKASDESRLISGDIPLIDYAKFKGCVTASELHDL
IRSFKILLIDFRASKDHNHNHINYPEIVNIEPSQVNNLIAQVPNCSDVDLEQKLSHIIPD
AHLARLKKRTSYDLVVIYNFNFGPTGANPNRFDALCERVIAGSRDRISSTPFDELIDILM
FRNKFPGHTLSRYPCYLAGGVSNWFEVFGKDSITRTIKDPVLQRPPASFSREGSTNSIPA
RKPSLKPVDEGQHTSPYLKNFGDYLSTVKSGSLRPVEPSFSLITTTQSVPSKASSSSSVS
IPVNPRPTQTVLAPKAPSRKPSLSNNVGASYQPKSSPLSSSSSSLMTQDTTTFLEQYTTG
LTNLGNSCYMNCILQCLGATPQLTGFFFPSLSTSASLENSSVQSYRQHINVNNRLGTKGI
LTTNFVTLLKNMFASTGAYFTPLEFKRVMGSLSPSKQFATYDQQDCIEFLEFLLDRLHED
LNQMVISDPEEKRAISELTPEQEKTREILPVRLASTIEWERYLKLNFSIIVDFFQGQYSS
QLRCLICGATSTTYNAFLILSLPIPTRLGSSPPVLLLDDCLDAFVTTELLDDDNKWFCPQ
CKKRTKLTKKLTITRLPQVLIVHFKRFKISPTGQFSKLDTFIKYPVNQVLDLTSYWPPVG
TSVNESMASSEVMLVEREQQVLSTLPTRNQVPPFRYKLFGVANHFGNLTTGHYTSYVRKK
SDAKKTREWCYFDDSKVTYNCKESQVLNKNAYCLFYQRI
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggaagtagccaggcttcgaaatgatgaagaactacgacaagtcgccactaag
atggctcaaaaactcttatttcacaccaagaaactatcatctttattgagttatgtgatc
tcattattggaagtgttcaagaaagaaatacaaaggaattccaaactagggtactgtgac
tatgaactagcgtttgtatgttatcaagccgctggtgtattgtgtaaggagtgtgaaaaa
caggataaaaacagtgatttggtgaaagcaaccagggatacttacaacctcaagaataac
gattatgctactatttcagcagttttagaagtatcggacaatcatccacagaaaaatgtt
ggtaatggattagatctagaagcggatttgttagcccgttttcaaaacttaaaatcactg
tcttcagatagttttgcgactaaagcgagtgatgagtctcgacttatctctggggatata
ccactaatagattacgccaaattcaagggatgtgtaacggcgtctgagttacatgacttg
ataagatcattcaagatacttttgatcgatttccgtgcttctaaagaccacaatcataat
catattaattaccccgagattgtgaacattgagccttcgcaagttaacaatttgattgca
caggttcccaactgctccgatgtcgacttggagcaaaagttgtcgcatataatccccgac
gctcatcttgcacgcctcaaaaaaagaacatcttatgacttggttgtgatatacaatttc
aactttggtccgacaggtgctaatcccaataggttcgatgcattgtgcgagagagtgata
gctggctctcgcgatagaatttcttccacacctttcgatgaactaattgatatactaatg
ttccgcaacaagtttccaggacacacattatcccgctacccttgctatcttgcgggcggc
gtgagtaattggtttgaggtttttggtaaggattctatcactagaacgatcaaagatcca
gtacttcaaagaccaccagcaagtttttcccgtgaagggagcacaaattctataccagca
agaaagccaagtttgaaaccagtcgacgaaggacaacatacgtcaccatatctcaaaaac
tttggtgattacttatccacagttaaaagtggaagcctgcgacccgttgagccttctttt
agcctgatcactactacgcaatctgtcccttcaaaggcttcctcaagttcaagtgtatca
atccccgtcaatcccagacccacccagactgtactggctccaaaagccccatcgaggaag
ccatccctgagcaataatgtgggtgcatcataccagccgaaatcaagtccactgtcttcc
tctagcagttcgctgatgacacaggatactacaacatttttggagcagtatactacggga
ttgaccaatcttggaaattcttgctatatgaattgcatattacaatgcctaggtgcaact
cctcaattaactggatttttctttcctagtttgagtaccagtgctagtcttgagaattca
tctgtgcaatcttacagacagcatatcaatgtgaacaatcgactcggcaccaaaggaata
ttgacaaccaactttgttacactattaaaaaatatgtttgcaagtactggtgcctacttt
acacctctggagttcaagagagtaatgggctctttatccccatccaagcagtttgccacg
tacgaccagcaagattgcattgagtttttggaatttttgttggacaggcttcatgaagat
ttaaatcaaatggtgatttccgatcccgaagaaaaacgggctatcagtgaacttactcca
gagcaggagaagacgcgagaaatattaccggttcgtttggcctcaacaattgagtgggag
aggtacttgaagctaaatttttcaatcattgtggatttctttcaaggtcaatactcttcg
caattgaggtgcttaatttgcggcgccacatcaacgacatacaacgcctttctgattctt
tcactacctataccaactcgccttgggagttctccacccgtactactgctagatgattgc
ttggatgcatttgtgaccacagagcttttggacgatgacaataagtggttctgtccgcaa
tgcaagaaacgcacaaaactgacaaagaaattgaccattaccagattaccccaggttttg
attgttcacttcaaaaggttcaagatctctccaacaggacagtttagtaagttggacacc
ttcataaaatatcctgtgaatcaagttctagatttgacatcctattggccgccagtcggc
acatccgtgaatgaatcgatggcaagttctgaggtcatgctggtcgaaagggaacagcag
gtacttagcacacttcccacgcgaaaccaggtacctcccttcagatacaagttgtttgga
gttgcaaatcattttggtaaccttaccaccggacattatacatcttatgttcgcaagaag
agcgatgcaaagaagactcgtgagtggtgctactttgatgattcgaaagttacctataac
tgtaaggagtcccaggttttaaacaagaatgcgtactgccttttctatcaaagaatatag

DBGET integrated database retrieval system