KEGG   Meyerozyma guilliermondii: PGUG_00492Help
Entry
PGUG_00492        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PGUG_00492
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_00492
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_00492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 879 aa AA seqDB search
MTSEVARLRNDEELRQVATKMAQKLLFHTKKLSSLLSYVISLLEVFKKEIQRNSKLGYCD
YELAFVCYQAAGVLCKECEKQDKNSDLVKATRDTYNLKNNDYATISAVLEVSDNHPQKNV
GNGLDLEADLLARFQNLKSLSSDSFATKASDESRLISGDIPLIDYAKFKGCVTASELHDL
IRSFKILLIDFRASKDHNHNHINYPEIVNIEPSQVNNLIAQVPNCSDVDLEQKLSHIIPD
AHLARLKKRTSYDLVVIYNFNFGPTGANPNRFDALCERVIAGSRDRISSTPFDELIDILM
FRNKFPGHTLSRYPCYLAGGVSNWFEVFGKDSITRTIKDPVLQRPPASFSREGSTNSIPA
RKPSLKPVDEGQHTSPYLKNFGDYLSTVKSGSLRPVEPSFSLITTTQSVPSKASSSSSVS
IPVNPRPTQTVLAPKAPSRKPSLSNNVGASYQPKSSPLSSSSSSLMTQDTTTFLEQYTTG
LTNLGNSCYMNCILQCLGATPQLTGFFFPSLSTSASLENSSVQSYRQHINVNNRLGTKGI
LTTNFVTLLKNMFASTGAYFTPLEFKRVMGSLSPSKQFATYDQQDCIEFLEFLLDRLHED
LNQMVISDPEEKRAISELTPEQEKTREILPVRLASTIEWERYLKLNFSIIVDFFQGQYSS
QLRCLICGATSTTYNAFLILSLPIPTRLGSSPPVLLLDDCLDAFVTTELLDDDNKWFCPQ
CKKRTKLTKKLTITRLPQVLIVHFKRFKISPTGQFSKLDTFIKYPVNQVLDLTSYWPPVG
TSVNESMASSEVMLVEREQQVLSTLPTRNQVPPFRYKLFGVANHFGNLTTGHYTSYVRKK
SDAKKTREWCYFDDSKVTYNCKESQVLNKNAYCLFYQRI
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggaagtagccaggcttcgaaatgatgaagaactacgacaagtcgccactaag
atggctcaaaaactcttatttcacaccaagaaactatcatctttattgagttatgtgatc
tcattattggaagtgttcaagaaagaaatacaaaggaattccaaactagggtactgtgac
tatgaactagcgtttgtatgttatcaagccgctggtgtattgtgtaaggagtgtgaaaaa
caggataaaaacagtgatttggtgaaagcaaccagggatacttacaacctcaagaataac
gattatgctactatttcagcagttttagaagtatcggacaatcatccacagaaaaatgtt
ggtaatggattagatctagaagcggatttgttagcccgttttcaaaacttaaaatcactg
tcttcagatagttttgcgactaaagcgagtgatgagtctcgacttatctctggggatata
ccactaatagattacgccaaattcaagggatgtgtaacggcgtctgagttacatgacttg
ataagatcattcaagatacttttgatcgatttccgtgcttctaaagaccacaatcataat
catattaattaccccgagattgtgaacattgagccttcgcaagttaacaatttgattgca
caggttcccaactgctccgatgtcgacttggagcaaaagttgtcgcatataatccccgac
gctcatcttgcacgcctcaaaaaaagaacatcttatgacttggttgtgatatacaatttc
aactttggtccgacaggtgctaatcccaataggttcgatgcattgtgcgagagagtgata
gctggctctcgcgatagaatttcttccacacctttcgatgaactaattgatatactaatg
ttccgcaacaagtttccaggacacacattatcccgctacccttgctatcttgcgggcggc
gtgagtaattggtttgaggtttttggtaaggattctatcactagaacgatcaaagatcca
gtacttcaaagaccaccagcaagtttttcccgtgaagggagcacaaattctataccagca
agaaagccaagtttgaaaccagtcgacgaaggacaacatacgtcaccatatctcaaaaac
tttggtgattacttatccacagttaaaagtggaagcctgcgacccgttgagccttctttt
agcctgatcactactacgcaatctgtcccttcaaaggcttcctcaagttcaagtgtatca
atccccgtcaatcccagacccacccagactgtactggctccaaaagccccatcgaggaag
ccatccctgagcaataatgtgggtgcatcataccagccgaaatcaagtccactgtcttcc
tctagcagttcgctgatgacacaggatactacaacatttttggagcagtatactacggga
ttgaccaatcttggaaattcttgctatatgaattgcatattacaatgcctaggtgcaact
cctcaattaactggatttttctttcctagtttgagtaccagtgctagtcttgagaattca
tctgtgcaatcttacagacagcatatcaatgtgaacaatcgactcggcaccaaaggaata
ttgacaaccaactttgttacactattaaaaaatatgtttgcaagtactggtgcctacttt
acacctctggagttcaagagagtaatgggctctttatccccatccaagcagtttgccacg
tacgaccagcaagattgcattgagtttttggaatttttgttggacaggcttcatgaagat
ttaaatcaaatggtgatttccgatcccgaagaaaaacgggctatcagtgaacttactcca
gagcaggagaagacgcgagaaatattaccggttcgtttggcctcaacaattgagtgggag
aggtacttgaagctaaatttttcaatcattgtggatttctttcaaggtcaatactcttcg
caattgaggtgcttaatttgcggcgccacatcaacgacatacaacgcctttctgattctt
tcactacctataccaactcgccttgggagttctccacccgtactactgctagatgattgc
ttggatgcatttgtgaccacagagcttttggacgatgacaataagtggttctgtccgcaa
tgcaagaaacgcacaaaactgacaaagaaattgaccattaccagattaccccaggttttg
attgttcacttcaaaaggttcaagatctctccaacaggacagtttagtaagttggacacc
ttcataaaatatcctgtgaatcaagttctagatttgacatcctattggccgccagtcggc
acatccgtgaatgaatcgatggcaagttctgaggtcatgctggtcgaaagggaacagcag
gtacttagcacacttcccacgcgaaaccaggtacctcccttcagatacaagttgtttgga
gttgcaaatcattttggtaaccttaccaccggacattatacatcttatgttcgcaagaag
agcgatgcaaagaagactcgtgagtggtgctactttgatgattcgaaagttacctataac
tgtaaggagtcccaggttttaaacaagaatgcgtactgccttttctatcaaagaatatag

DBGET integrated database retrieval system