KEGG   Meyerozyma guilliermondii: PGUG_00588Help
Entry
PGUG_00588        CDS       T01150                                 

Definition
similar to histone acetyltransferase
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 389 aa AA seqDB search
MPSQTQLITAKSKPGKQKLAPEKERFLLCCGDISLELVASLKNSKDINLNGLIIRYAKKY
KLKQQPRLTDIISSIPDQYKKYLIPKLKAKPVRTASGIAVVAVMCKPHRCPHIAYTGNIC
VYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQLRQLGHSIDKVEYII
MGGTFMSLPVDYREGFITQLHNALTGYNGRDIDEAIKFSQQSQTKCVGITIETRPDYCTE
THLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCETFAVAKDAGYKVVSHMMPDL
PNVGMERDLEQFKEYFENPDFRTDGLKLYPTLVIRGTGLYELWKKGLYKSYNANALIDLV
ARILALVPPWTRIYRVQRDIPMPIGDIWS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacaaacccaacttataactgcgaagagcaagccagggaagcagaaactcgct
ccagagaaggagagattcttgctgtgctgcggagacatttccttggagcttgtggcatcg
ctaaaaaattccaaagatatcaatttgaatggtttaatcatcagatatgcaaaaaaatac
aagttaaagcaacaaccacggttgaccgatatcatttcatccatcccagatcaatataaa
aagtacttgataccaaaactcaaggcaaaacctgtcagaacagcatcaggaatcgccgtt
gtggcagtgatgtgcaaacctcatcgatgcccccatatagcatatactggtaatatttgt
gtttattgcccaggtggtcctgattcggactttgaatattctactcaatcgtatactgga
tacgaacctacatcgatgcgtgctattcgtgcaagatatgatccatatgaacaagcgcga
ggaagagtggaacagttgagacaattaggacattctattgataaagtcgagtacattatc
atgggaggaacgttcatgtctcttcccgtggattacagagaagggttcatcacccaattg
cataatgctttgaccggctataatggtcgcgatatcgatgaggccatcaagttttctcaa
caatctcaaacaaaatgtgttggtatcactatagaaacaagacccgattactgtacagag
actcatttgagtgatatgctcaagtatggatgcacaagacttgaaatcggtgtacaatca
gtatacgaagatgtggctcgtgataccaatcgaggccacaccgtgaaagccgtatgcgaa
acttttgcagttgcaaaggatgctggctacaaggtggttagtcatatgatgcctgacttg
cccaatgttggtatggagagagatttggaacaatttaaagaatactttgaaaacccagat
ttccgaactgatggtttgaaactttacccaaccttggtgataagaggaaccggattatac
gaactttggaagaaaggtttatacaaatcatacaatgcaaatgcgttgattgacttggtt
gcaagaatcttagcgttggttccaccatggacaagaatctatcgagttcagcgtgatatt
cctatgccgattggtgacatctggagttga

DBGET integrated database retrieval system