KEGG   Meyerozyma guilliermondii: PGUG_00620Help
Entry
PGUG_00620        CDS       T01150                                 

Definition
similar to histone H2b
Orthology
K11252  
histone H2B
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASSDSKKRTKTRKETYSSYIYKVLKQTHPDTGISQK
AMSIMNSFVNDIFERVASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEATRT
ITKYSSAAN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaaggctgaaaagaaacccgcttccaaggctccagctgagaagaaaccagct
gctaagaagactgcttcttctgactccaagaagagaaccaagaccagaaaggagacttac
tcttcttacatctacaaggtgttgaagcaaactcaccctgacactggtatctcgcaaaag
gccatgtctatcatgaactcttttgttaacgatatctttgagagagttgcttctgaggct
tccaagttggctgcttacaacaagaagtccaccatctctgctagagaaatccaaactgct
gttagattgatcttgcccggtgaattggccaagcacgctgtttctgaggctaccagaacc
atcaccaagtactcttctgctgctaactaa

DBGET integrated database retrieval system