KEGG   Meyerozyma guilliermondii: PGUG_00766Help
Entry
PGUG_00766        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pgu00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pgu00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:pgu00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:pgu00311]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:pgu04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MHNIVVIGAGVVGLTNALEIKRAFPGVSVTIVAKNLPGDLTTEYTSPFAGANWESFASNE
DKALQEMDAVGYHRLIELCDEPAAGIWRKENFIYFDETKLKENDSDILKLRPWFKSVVNN
YRELDASELPEGAVWGYSYGGLVISVPIYLQYLVGQCLREGIVIRRTKELKSVQEARKLH
SSGQDAHTVINCAGILVSRLGGFKDPSKLYPVLGQVLLTRNSLENIEIFELSDPDYPDEI
PYLFPRKEGGSIIGGCFRKNIGPGPVVEDKELTKRLIQRATRLVPQLTDTSYKNNPGHID
IVRVAVGLRPFREDGIRIEQDSEHEWLIHSYGAGAGGYQGSYGFSHKVVQLLATRINNSK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgcacaatatagtagtgataggagctggggttgttgggttaaccaatgctttggaaatc
aagagagcgttccccggtgtatcggttacaatagtagctaagaatcttcctggtgatttg
actacggaatatacctctccttttgctggtgcaaattgggaatcctttgcaagtaatgaa
gacaaagccctccaagaaatggacgcagttgggtatcataggttgattgagctctgtgat
gaaccagctgcgggaatctggcgcaaagaaaatttcatctactttgacgaaaccaaactc
aaagaaaatgactcagacatactgaaactacgtccttggttcaaatcagtggtgaataat
taccgagaattggatgcctctgagctaccagaaggtgccgtctggggctactcgtatggc
ggattagtcatttctgttccaatttatttgcaatatctcgttggacagtgcttgagggaa
ggcatagttataaggagaaccaaagaattgaaatcggttcaggaggccagaaagttacac
agcagtggtcaggatgcacacaccgtcatcaactgtgctgggatattagtttcacgcttg
ggaggttttaaagatcccagcaaactgtacccagtattgggccaagtattactcacacgt
aatagcttggaaaacatagaaatattcgagctttctgatcccgattaccctgatgaaatt
ccatacctttttcctcggaaagaaggtggctcaataataggaggctgctttcggaaaaat
attgggcctggtcctgtggtagaggataaagaattaacgaagcgtttaattcagcgagcc
acaaggttagtaccgcaacttactgacacaagctacaaaaacaatccaggacacatagat
atagtgcgagtggctgttggattacggccatttcgtgaggacggaattcgaatcgagcag
gactcagagcacgaatggttaattcatagctatggagctggagctggcggttaccaaggt
agctacggattcagccacaaggtggtgcaattacttgcaacccggataaacaattccaaa
ttatag

DBGET integrated database retrieval system