KEGG   Meyerozyma guilliermondii: PGUG_00992Help
Entry
PGUG_00992        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
pgu  Meyerozyma guilliermondii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    PGUG_00992
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     PGUG_00992
Protein kinases [BR:pgu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   PGUG_00992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 402 aa AA seqDB search
MTDPLFKVPPTKRAGPVLAPLSTRTNNAPRRKPPPIDFLLVNGLHSFDTDGESGQKKETT
PQMAQIHNETYAGDSTPASSKAETNQSPLLTGECSHLDDITPEQWNQLANNNRIVELTCL
GEGNGGSVSKCRLAQGSPVFALKLIKVDTNPLIQKQILRELQYNRLCKSRNIVRYYGTFL
IESQQMIGIAMEYMGGRSLDAIYKRVIELDPSNRINEKVLGKIGESVLNGLNYLHQQKII
HRDIKPLNILLDSQGNVKLCDFGVSGEVVDSLATTFVGTQYYMAPERIQGKPYTVTCDVW
SLGLTMLEVASCKFPFTVDNPQLGPIELLQLILEYEPKLKDVPEDGIYWSEAFKSFISYC
LKKEPTERPSPRQMLNHPWCVGQSNISVRMDGFIRRLWDIID
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcccctattcaaagttccccctaccaagcgggcagggcccgttcttgctccg
ctctccacgcgcacaaacaatgctcctcgtcgaaaaccgcctccaattgattttctgctt
gttaatggcctgcactcatttgacaccgacggagaaagcggccaaaaaaaggagacgacg
ccccaaatggctcagattcacaacgagacgtatgcaggggactccactccagcgtcttcg
aaagcggaaaccaatcaaagtccgcttttaactggagaatgctcacatctcgatgacatt
acaccggaacaatggaaccaacttgccaataacaaccgcatagtagagctcacgtgtttg
ggagagggcaacggtgggtctgtctccaagtgtaggcttgcacaagggtcgcctgtgttt
gctttgaaactcatcaaggtggataccaatccgttgattcagaaacaaattcttcgtgaa
ttgcagtacaatcggttgtgtaagtcgcgcaatattgttcgctattacggaacattcttg
atcgaaagccagcagatgatcggtatagccatggagtatatgggaggccgatccttagat
gccatttataagcgagtaatagaactcgacccatcaaaccgaatcaacgaaaaagtgtta
gggaaaattggcgaaagcgttctcaatggcctcaactacctccaccaacaaaagattatc
catcgagatattaaacctctgaatattttgctcgatagccagggcaatgtcaagttatgc
gactttggcgtttccggagaagttgtggactcgctagcaacaaccttcgtggggacccag
tactatatggctccggaaagaattcagggaaagccttacaccgtcacttgcgacgtatgg
tcgttagggttgactatgcttgaagtggctagctgcaaatttcccttcaccgttgataat
ccgcaattgggcccaattgagctcctccagctcattctagagtacgagccaaaacttaag
gatgtgcctgaagatggaatttattggtctgaagcgttcaaaagctttataagttactgt
ctcaaaaaagaacctacagaacgacctagtccgcggcaaatgttgaaccacccgtggtgt
gtgggtcagagcaacatctctgtacgcatggatggcttcatacgccgtctatgggatata
attgattaa

DBGET integrated database retrieval system