KEGG   Meyerozyma guilliermondii: PGUG_01075Help
Entry
PGUG_01075        CDS       T01150                                 

Definition
similar to potential glycerol kinase Gut1p
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PGUG_01075
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PGUG_01075
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PGUG_01075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 629 aa AA seqDB search
MPRRQSTAPTQPVVGTIDIGTTSARAILFSQEGIEIAKHQIEYSTSASEAPAESKNKEQF
RRRSSLMRHNEPIFTSEGIAISISDDVEIENNRASVGPTLRFPQPGWSECMPVHVLANAV
QCLVACLITLRKVNQNPDLKIKYKVKALGIANMRETTIVWLKRTGKPLSNGITWTDTRTA
EIVQHLEKMTDDDRKEELKQKTGLPLSTYFSAAKLRWLLDNDDTIREEYEKGDGNLMFGT
VDTWLIYHLSKERSFVSDVTNASRTYFMDLETKDYDDDLLDFWGIDPTKICLPKIVSSSE
HYGSFAAPNLSNLGFHNKITPEAYEILKTITGVPICGCLGDQSASLVGQLAFRAGSAKCT
YGTGCFLLYNTGTRKLISDHGTLTTLGFWFPTLEGDDAQPHYALEGSIAVAGSIIQWLRD
NLKLIENAKDIGPLASQVDNSGGVVFIPAFSGMYAPYWDGGARGTIFGMTQYTSSSHIAR
AALEGVCFQVRAILRAMASDAGGSEDFLEEASSIQGSKRPLSKLAVDGGMSKADEVLQIQ
ADILGPCVDVKRAKISECTALGAAIAAGLSFKNPEDRIWKDLNDVIEKIDGPTDAQNSFK
AKLPDNDRRTMWKRWENAVSRAKGWLDDV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcgccagagcaccgcgcccactcagcccgtggtgggtaccatagacattgga
acaacctcggcgagagccattcttttcagccaagaaggtatcgaaatcgccaagcatcaa
attgaatattcgacgtcggcttctgaggcgccagcggaatcgaaaaacaaggaacaattt
agaagaagatcgtcgcttatgcgtcacaacgagcctattttcacctcggaaggtattgca
atttccatttctgacgatgttgaaatcgaaaacaatcgtgccagtgtaggaccaacttta
cggttcccccaaccaggatggtccgaatgtatgcccgtgcatgttcttgccaacgcggtc
cagtgtttggtggcatgtttgattactttgcgtaaagttaatcagaaccctgatctcaaa
atcaagtacaaagttaaggcacttggtattgccaatatgagagaaaccaccattgtgtgg
ctgaaaaggacgggaaagccattgagcaatggtatcacatggaccgacaccagaacagcg
gaaattgtacaacatttagagaaaatgaccgacgatgatagaaaggaagaattgaagcaa
aagacaggattgccgctaagcacctatttttccgctgccaagttgcggtggttgctcgat
aatgatgatacaatcagggaggagtacgaaaagggcgacggaaacctcatgtttggaacc
gtagatacttggttgatctaccatctttccaaagaacgttcattcgtgtctgatgttacc
aatgcttccagaacctattttatggacttggaaacaaaagactacgatgatgatctcctt
gatttctggggcattgatcccaccaaaatttgcttgcccaaaatcgtttccagttccgaa
cattatggttcgttcgcagcaccaaacttgtccaaccttggattccacaacaaaatcact
cccgaagcctatgagatcttgaagactattactggtgtacccatctgtggttgtcttgga
gaccaatcggcgtcgttggtgggtcaattggcgttccgtgctgggtctgcaaaatgtact
tatggtaccggatgtttcttgttatacaataccggaaccagaaagttgatttctgaccac
ggaactttgactacacttggtttttggtttcctacgttagaaggtgacgatgctcagcca
cattatgctttggaaggatccattgccgttgctgggtccatcattcaatggcttcgagac
aacttgaaactcattgaaaatgccaaagatattggaccacttgcttctcaagtggacaac
tctggtggtgtagttttcattccagcattttcaggaatgtatgctccatattgggatggt
ggtgctagaggtaccatttttggtatgacccagtatacatcatctagtcatattgccagg
gctgctttggaaggtgtatgttttcaagtgagagccatcttgagagccatggctagcgat
gctggaggaagtgaggatttcctcgaagaggcatcctcgatccagggttcaaagcggccg
ctttctaaattggccgtagatggaggaatgtccaaagcagatgaagtgttgcaaatccaa
gccgacattctcggaccatgtgtggatgtcaagcgtgccaagatctccgagtgcacggct
ttgggagctgccattgctgcgggactttcgttcaaaaatccagaagacagaatctggaaa
gatttgaatgatgttatcgaaaagatcgacggtccaaccgacgcccagaattcgttcaag
gccaaattgccagataacgacagaagaacaatgtggaaacggtgggagaatgcagtttcg
agagccaagggctggttggatgatgtgtag

DBGET integrated database retrieval system