KEGG   Meyerozyma guilliermondii: PGUG_01119Help
Entry
PGUG_01119        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pgu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 420 aa AA seqDB search
MEQTSYIIVVKLGTSSIVDEQTMEPRLANLSRIVETLVKLRRQGHRIIIVSSGAIAIGMK
TMGLSSKPAALSEVQALASIGQSRLIGLFDTLFRQFDQRIAQILFTRNDILDFNQYKNAI
NTLQQLMLMGVIPIVNENDTLSVSEIKFGDNDTLSAITAGMVHADYLFLMTDVPCLYTDN
PRSNPDAQAVLLVEKMENLDIKSDSKAGAGSKVGTGGMTTKLIAAELATNVGVHTIIALS
TQPNYILDIVNNIVEMDKLKLTMEEQTEFVDRAIKDGKIPLHTRFLGLPRQTKIISDKRF
WLLHGNKTKGALIIDQGCFEALTRKNRAGLLPVGIVGVEGSFHDSESVSLKVVPTKDSDP
SEAVLVGNCRVNYSSNEIELIMGKHSHEIESILGFADSEYVAHRDNIAFPPFAPSTDSLA
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaacctcgtatataatagtggtaaagttgggaacctcgtccatagtggatgag
caaaccatggaaccacggttggccaatttgtctcgtatagtggagacacttgtcaagctt
cggagacagggccatcggatcattattgtgtcttctggtgccattgccattggaatgaaa
accatgggattgtcatctaagcctgctgcgctttccgaggttcaggctttggcgtccata
ggtcaatctcggctcattgggttatttgatacacttttccgtcaatttgatcagagaatc
gcccaaattttattcacaagaaacgatattctggactttaaccaatacaaaaacgccata
aataccctccagcagctcatgctgatgggtgtgataccaattgtcaatgaaaatgataca
ttatctgtttctgaaatcaagtttggtgataatgataccctttcggctattaccgcagga
atggttcatgctgactatcttttcctcatgaccgatgttccttgtttgtacacagacaac
ccgagaagcaacccagatgcccaggctgtgttgttggtggaaaaaatggaaaatttggac
atcaagtcggactccaaagccggtgctggttctaaggttggaaccggtggaatgaccaca
aaattaatagctgccgagctcgcaacaaatgttggtgttcataccattattgcgctttcc
actcagcccaactatattcttgatattgtcaacaatattgtggaaatggataaactcaaa
cttaccatggaagagcaaaccgaatttgtcgatcgggccataaaagatggaaagattccc
ttgcacacaagatttcttggacttcctaggcaaacaaagatcatttccgataagcggttc
tggcttcttcatggaaacaaaactaaaggtgctcttattatagatcaaggctgttttgaa
gctctcactcgaaagaatcgtgccggtttacttccagtgggaattgttggagttgaagga
agctttcacgatagtgagtctgtgtccctaaaggtcgttcctactaaagactcagaccca
tctgaggcagttcttgttggaaactgtagagtcaattacagctccaatgaaattgaactt
ataatgggaaaacatagtcacgaaatcgaaagcatattggggtttgcagatagtgagtat
gttgctcacagagacaacattgcatttcctccgtttgcaccttctacggactcattggca
tga

DBGET integrated database retrieval system