KEGG   Meyerozyma guilliermondii: PGUG_01172Help
Entry
PGUG_01172        CDS       T01150                                 

Definition
phosphomannomutase
Orthology
K17497  
phosphomannomutase [EC:5.4.2.8]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pgu00051]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pgu00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MSFSNKENPKTLVLFDVDGTLTPARLTISEEMKKTLEKLRSKVVVGFVGGSDFSKQVEQL
GPNILTEFDYCFSENGLTAYKLGEKLASQSFINWIGEEKYNKLAKFILRYLSDIDLPVRR
GTFIEFRNGMINVSPVGRNASTQERNDFEAYDKIHNIRSTMVNALKKEFPDLGLTYSIGG
QISFDVFPTGWDKTYCLQHVEDEGFTEIHFFGDKSYEGGNDYEIYNDKRTIGHAVKSPDD
TIKILTELFNL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctccaataaagaaaacccaaaaactctcgttttgttcgatgtcgacggaaca
ttaacccccgccagattgaccatttctgaagaaatgaagaaaaccttggaaaaattgaga
agtaaagtggtggttggtttcgtcggtggttcggacttttccaagcaagttgaacaattg
ggtcctaatattttgaccgaattcgactactgtttctcggagaatggattgaccgcctac
aagctcggcgagaagttggcttctcaatctttcatcaactggattggagaggaaaaatac
aacaagttggccaagttcatcttgagatatttgagtgatatcgatcttcctgttagaaga
ggaactttcatcgagtttagaaacggtatgatcaacgtttcacccgtgggaagaaacgcg
tctacccaagaaagaaacgatttcgaggcgtacgacaagatccacaacattcgttccacc
atggtcaacgcgttgaagaaagaattccctgacttgggattgacttattccattggaggt
caaatttcgtttgatgttttcccaaccggatgggacaagacctactgcttgcagcatgtt
gaagacgaaggattcaccgagatccactttttcggtgacaagtcttacgagggaggtaat
gactacgagatctacaacgacaagagaaccattggtcatgccgtcaagagcccagacgac
accatcaagatcttgaccgagttgttcaacttgtag

DBGET integrated database retrieval system