KEGG   Meyerozyma guilliermondii: PGUG_01172Help
Entry
PGUG_01172        CDS       T01150                                 

Definition
phosphomannomutase
Orthology
K17497  
phosphomannomutase [EC:5.4.2.8]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Fructose and mannose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PGUG_01172
   00520 Amino sugar and nucleotide sugar metabolism
    PGUG_01172
Enzymes [BR:pgu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     PGUG_01172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MSFSNKENPKTLVLFDVDGTLTPARLTISEEMKKTLEKLRSKVVVGFVGGSDFSKQVEQL
GPNILTEFDYCFSENGLTAYKLGEKLASQSFINWIGEEKYNKLAKFILRYLSDIDLPVRR
GTFIEFRNGMINVSPVGRNASTQERNDFEAYDKIHNIRSTMVNALKKEFPDLGLTYSIGG
QISFDVFPTGWDKTYCLQHVEDEGFTEIHFFGDKSYEGGNDYEIYNDKRTIGHAVKSPDD
TIKILTELFNL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctccaataaagaaaacccaaaaactctcgttttgttcgatgtcgacggaaca
ttaacccccgccagattgaccatttctgaagaaatgaagaaaaccttggaaaaattgaga
agtaaagtggtggttggtttcgtcggtggttcggacttttccaagcaagttgaacaattg
ggtcctaatattttgaccgaattcgactactgtttctcggagaatggattgaccgcctac
aagctcggcgagaagttggcttctcaatctttcatcaactggattggagaggaaaaatac
aacaagttggccaagttcatcttgagatatttgagtgatatcgatcttcctgttagaaga
ggaactttcatcgagtttagaaacggtatgatcaacgtttcacccgtgggaagaaacgcg
tctacccaagaaagaaacgatttcgaggcgtacgacaagatccacaacattcgttccacc
atggtcaacgcgttgaagaaagaattccctgacttgggattgacttattccattggaggt
caaatttcgtttgatgttttcccaaccggatgggacaagacctactgcttgcagcatgtt
gaagacgaaggattcaccgagatccactttttcggtgacaagtcttacgagggaggtaat
gactacgagatctacaacgacaagagaaccattggtcatgccgtcaagagcccagacgac
accatcaagatcttgaccgagttgttcaacttgtag

DBGET integrated database retrieval system