KEGG   Meyerozyma guilliermondii: PGUG_01229Help
Entry
PGUG_01229        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
pgu  Meyerozyma guilliermondii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PGUG_01229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1838 aa AA seqDB search
MATPSFLCVPLFLGALIHAVHRSIFQNIFAENNSMHWSIEPFEECYNSIRKFGSVDQNLL
ENISEDLLSLLIHPGRNDKSKSQLINENEPITFSNGDQYRLNREFIDVSGVLAAELDLDE
IATAELLWYANKLSFNNGTSFIDSGRYAYFTRAQYILNILGYLTLQEELGMVVKDYQKFL
DNVLQSFKIIYSHVSTLNELIDKQKVTGDINNLQFTSAIAYLRSNLFKFHELLGELLFGL
FSRYFAHYNTSQHFTKNIDHIKQNVADEDVLIFHYLPALFSFVNHLDKIKDVDQLHRSIT
SKLNQDYLKLSSADEVRISNSNLKGFEVLIYMFFFIYFITWCKSLDERIRKFDFKEDCLK
YIEIVISYGAAEKLLCCTADSAHPKTTELIEMKNLYDFRSLLQKVFPRFTSVKFAYPNQD
LQSIVSANPELTNINALLVTYSVSDEFNENLLAPFYHEFFREFVNNAAIVMTLLRDNEED
FLLSSLNKQLLDDPNAASKKANSNDFAGVDLDEIAEVADLERLYLAFSYSYLHRPELCAM
LWVDEELSPDIVGFINWGLSYNTSPLIASTFCLLLGSITYAGPSSAVKVWDLLVSNNNAS
LKKNDYSKISLDSIVDSLEYYIGALFENFENDLNEQLKQQQKRQDYMFSANFASESDSRN
ITIELAEDSIVFISGFVQLISLIVRNISSYPAASTLLASDSSNLKNTIFNRFLPLITDFL
KFDNTIMGIKNSTGDNKIYEGSITVNTETRVVLINLMLNFLEDFVHANDDLTLRYQIWNL
IDKWFCHALAEKENQSNGFLNNNVKRSRVKLVRIEDGFHMNLSHISQVNNFVDLLILLLK
PLHNTHQAFITYKLLYPPDLGDGHRPQDHIGIWPYMEYLLVEVFGKSTQVDEKFRILLQL
KLVKLMELSLNEIDWQFLAVVAPKLIRNYDISSIFDTSYAPLDFQLFAKLHHSIAILHYT
YEDSVTRSLFSIVDTGIEGLNSSPKSETLVENCLKVADKILLLQDFYVGQALPVLRDTAK
PPTSSHTSMSLVAASNNIYDRVSLPQNLGNGVVDFFQVFLFNLSSVATLALYVGSDSIPI
AKVSLEILKKLASSQFFDGQSGAENLTDSNRLLTIFKSVDESDRIKFGFIQQLQKDTESI
EILELKLQILNFLIDNLQLHRMSVSHFLLGFKSQGGIIHLDPSDEHNTLLKSLLVSLDTF
FRSMAELDYQNGNRHVIDVGSTTLVSLIMDLIANLCRHPQTSSTTLSYIKGLVNVDIFRV
SVEAQPVVDVRTIWFDTEFDGELHERLQNKFIQSNLAVGSFFAFIKQRNLVFQLLALDML
NFSDNSSLMKKKAYKQLLLAGQNTLNGAPKLLSFLDVLNYEFSDFGDLKVETYSQKYDLK
YFFELLQNKPSGLGRAVDLSVIEKTFMLLCRNQSDSILSDLTKESISQLIITEGNYLADY
MTKLVFSQELEDLQVSCLHSWSQLVQALLLDDSMESSERINFIMEVFQIILPKINDSYDT
RIRFCEELISLCVPLFEVFDTDQSKKEDVEERIHKSIPLLLTCIKGITSSTSTPELRSDL
YVLSTKYLQQVMGHETLELVTKNLVKSNDTRLLATVCNDAICAEGAPRITSLLFLESLIH
LASNCKDDFAMETILKTNSLVLLVHSLKRTDEVITEFLKDGSLNMHMGVESLVYELISFK
TMLYVFLRIAQTRTGASQLVQNDIFTIFKLLKFISIDPDLGMDLRLRPQGDGNKFELNFS
LDHNLTFSGDPDDGISYFEFLIPAFQVINAILLAMGPSYKPTVIQAKDLMRHFRVLIVGV
LKRDVLLAEKKKTNYTAGLHQLIELFTLLDTLVTQSEE
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggctactccatcttttttatgtgtccctcttttccttggtgctctgattcatgcagtc
catcgctcaatatttcaaaacatcttcgctgagaacaacagcatgcactggtctatcgag
ccttttgaggaatgctacaattccattcgaaagtttggttctgtggaccaaaatcttcta
gagaacattagtgaagatctattgtctcttttgattcatcctggaagaaacgacaaatcc
aagtcgcagctcatcaacgaaaacgaacctatcacgttctccaatggtgaccaatataga
ctcaacagagagttcattgacgtctcgggagtgcttgcagcagaacttgacttggacgaa
atagcaactgccgaacttctttggtacgccaacaaattatctttcaacaacggcacatct
ttcatcgacagtggtcgttacgcatatttcacaagagctcagtatatccttaatatcctt
ggatacctcacactgcaagaggagctcggaatggttgtcaaagactaccaaaaatttctt
gacaatgttttacaaagtttcaaaatcatatactcacacgtgagtaccctaaatgaactt
attgataaacaaaaggttacaggtgacattaacaatctccagtttactagtgccattgct
tacctgcgctcgaacttgttcaaatttcacgaactacttggtgaactattgtttggactt
ttttccaggtactttgctcactacaatacttctcaacatttcacaaaaaatatcgaccat
atcaaacaaaacgttgccgatgaagacgttctcatctttcactacctccctgctcttttc
tcctttgtgaatcacctcgacaaaattaaagacgtcgaccaactccacaggtccatcacc
tcaaaattgaatcaagattacctgaaactttccagtgccgatgaagtccgcatatccaac
tcaaacctaaagggattcgaagtccttatttacatgttcttcttcatctactttattact
tggtgtaagtcgctggatgagagaatacgaaaattcgatttcaaagaagactgcctcaaa
tacattgagattgtgataagctatggcgctgcagaaaagcttctttgctgcacagctgat
tctgctcaccccaaaaccacagaactcattgaaatgaaaaatttgtacgattttcgttca
ttgttacaaaaggtgtttccaagattcacctctgtcaaattcgcctatcccaaccaagac
ttacagagcatcgtaagcgccaacccggaattgacaaatatcaatgcattgctcgttacc
tattcagtttctgatgaatttaacgaaaacttactagcacccttttatcacgaatttttc
agagaattcgttaataacgcagcaattgtgatgacactgttaagggacaacgaagaggac
tttttgttgtcgtcgttgaataaacagctcttggacgatcccaacgctgcttccaagaaa
gcaaattcgaacgattttgctggtgttgatcttgatgaaattgcagaagtcgcagacttg
gagagattgtatttggcgttcagttatagttatctccaccgtccagagctttgtgctatg
ctctgggtcgatgaggaactttcacccgacattgttggctttatcaactggggactcagt
tataatacctctccattaattgcttcgactttttgcttgttacttgggtccattacttat
gctggtccaagctctgctgtcaaggtgtgggacttgttggtcagcaacaataatgcctcc
ttgaagaagaacgattactcgaaaatatcacttgactcgattgtcgactctttggaatat
tatattggcgccttgtttgaaaacttcgaaaacgacttgaatgagcaactaaagcagcaa
caaaaaagacaagactacatgttttcagcgaactttgcatcggaatctgactctcgcaat
attacaattgaattagcggaagactccattgtgttcatttctgggttcgttcagcttatc
tcgctgattgtgagaaacatctcatcgtatcctgcagcttcaacgttgctggcctcagat
tcctccaaccttaagaacacaatcttcaaccgctttttacctctcatcaccgatttcctc
aagtttgacaacacaataatgggaatcaaaaacagcacaggcgataacaaaatttacgaa
ggtagcatcacagtcaacacagaaacgagggtagtgttgataaacttgatgctaaacttt
ttggaagactttgttcatgcgaacgatgacttgaccttgcgataccaaatctggaatttg
attgacaagtggttttgccatgcccttgccgaaaaagagaatcaatccaacggctttttg
aataacaacgttaaaagaagccgtgtgaaacttgtcagaatcgaggatggatttcacatg
aacttatcacatatttcacaggtcaacaattttgtcgatttgttgattctgttactaaag
ccgttgcataacactcaccaagcattcataacatacaagctcttgtatccacccgacctt
ggtgatggccacagacctcaagatcatataggaatatggccatatatggagtacctattg
gtggaggtattcggaaagtcaacccaagttgatgagaaatttaggatactgcttcagctc
aagttggtcaagcttatggagctgtctttgaatgaaattgactggcagttcttggctgtc
gttgctccaaagctcattcgaaactacgacatcagctcgatcttcgacacctcgtatgcg
ccattggattttcaactctttgcgaaacttcaccattcgattgcaattcttcattacacc
tatgaagacagcgttacgagatctttgttctctatcgttgacactggtattgaaggactt
aatagctctccaaaatcagaaactttggttgaaaactgtttgaaagttgcagataagatc
ctactgttgcaggacttttatgtcggccaggcactcccggtattgagagacacagcaaaa
ccgcctacctcgtcgcatacatcaatgtctttagtcgcagcttctaataacatctacgac
cgtgtgagtctcccacaaaatttgggaaacggcgttgttgactttttccaggtctttttg
ttcaatttatcgtccgttgcgacattggccttgtacgttgggagcgacagtataccgatt
gccaaagtttctcttgagatattgaagaaacttgccagttctcaattcttcgatggtcaa
tcaggtgccgaaaatcttacagacagcaaccgtcttttgacaattttcaaatctgtggat
gaatctgacagaatcaagtttggattcattcagcagctacagaaggatactgaaagcatc
gagattttggaactcaaattacaaatcttgaatttcttgattgataatcttcagctgcac
cgaatgtctgtctctcactttttattgggattcaagtcccagggtggtatcatacacctt
gatccatctgatgagcacaataccctcttgaaatcgttgcttgtgtctctcgatactttt
ttccggtccatggctgagctagactatcagaacggaaacaggcatgtaattgatgttggt
tccaccactcttgtttccttgatcatggatttgatagcgaacctttgtcgtcatcctcag
acatcatcaaccactttgtcatacataaaaggactggttaatgtcgatattttccgagtc
tctgtggaagctcaaccagtcgttgatgtgcgaaccatctggtttgacacggagtttgat
ggagaattgcacgaaaggttgcagaacaaattcatacagagcaatttagctgttgggtct
ttctttgcatttataaagcagaggaaccttgtgttccagctccttgcacttgatatgctt
aatttttcagataacagttctttgatgaagaagaaagcgtacaagcagttacttctagct
ggtcaaaacaccttgaatggagctccaaagttgctttcgtttctagacgtactcaattac
gaattcagtgactttggggacttgaaagtggagacttattctcaaaagtacgacttgaag
tacttttttgagttattgcaaaacaagccgtcgggcttgggccgagccgtcgatctctct
gtgattgagaaaactttcatgcttctttgcagaaaccagagcgatagtatactatcagat
ctcacgaaagagtcgatatctcaactgattataactgaaggaaactacctagccgattat
atgaccaaattggtgttctcacaggagcttgaagacctccaggtttcgtgcttacactct
tggtcccaattagttcaagcgcttcttttggacgattctatggaatcatcggagaggatc
aattttatcatggaagtgttccagattattctccccaaaatcaatgattcttatgatacg
aggataaggttttgtgaagagttgatctcattatgtgttcctttgtttgaagttttcgat
acagatcaatcgaaaaaagaagatgtggaggaacgtatccataagtcgattcctttgctc
ttgacatgtatcaaaggaataacgtcatccacctctactccagaattgaggtctgacctt
tacgtgctttctaccaagtatcttcaacaagtaatggggcacgaaacattggagttggtg
acgaaaaatttggtcaaatccaacgatacgagattgcttgcaactgtatgtaacgatgca
atttgtgctgaaggggcgccaagaatcacgtcgctcttgttccttgaatcgcttattcat
ctagcatccaactgcaaagacgattttgccatggaaaccatcttgaagaccaactctctt
gtattgttggtacattcgttgaagcgtaccgatgaggtgataacagagtttctgaaggat
ggctctctgaatatgcatatgggagtagagtcgttggtatacgaactcatttcattcaag
accatgctttatgtgtttttgcgtattgctcaaacgagaacaggtgcatcccagcttgtt
caaaatgacatttttaccatattcaagctgttgaaattcatatccatcgatcctgacttg
ggcatggacctcaggcttagaccacaaggcgatggaaataagtttgagttgaatttttca
ctcgaccataacttgactttttctggtgatcccgatgatggtatttcatattttgaattt
ctcatccctgctttccaagtgataaatgctattttattggcaatgggtccatcatataag
cccactgtgatccaagcgaaagatttgatgcggcatttccgagtattaatagtaggagtt
ttaaagagagatgttctcttggccgagaagaaaaagacaaactacactgcagggttgcac
cagttgatagagttgtttacattgttagacactttggtgacacaaagtgaagagtga

DBGET integrated database retrieval system