KEGG   Meyerozyma guilliermondii: PGUG_01253Help
Entry
PGUG_01253        CDS       T01150                                 

Definition
similar to MpkA
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pgu  Meyerozyma guilliermondii
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:pgu04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 466 aa AA seqDB search
MAPTESSVPPSTMMGPDPTTATLWPSRKSPISSRKKSCVKDRCVSSSFFSSSAATRTLLV
YMTWISCPTRSRETLTKYTFYEELMECDMHQIIRSGQALTDSHYQSFIYQVLCGLKYIHS
ADVLHRDLKPGNLLVNADCELKICDFGLARGFLEDPEQNAGFMTEYVATRWYRAPEIMLS
FTNYSKAIDIWSAGCILAELLGGKPLFRGKDYVDQLNQILLVLGTPDEPTLTKIGSVRAQ
NYVRSLPAMRKVPYNEIFPNANPLALDLLEKMLTLDPFKRITVEEALEHPYLSVWHDPQD
EPRCQVKFDFKSFEKADDMNIMKRLIMEEVKNFRDFVRRPIEEQQQIQLQMQMQQQDIQQ
HHQNHVQMGLPNPLAANQYSDVLNPYSSHSNSSLNNNAEVNTDPSQMNNDLQFYESVPKP
QELPEFPFSPHHPSHDVHKPSPMDDDLFRLEEELGFGLDGGMYNNI
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctacggaatcgtctgttccgccaagtacgatgatgggtccggatccgacgacg
gcaactttgtggccatcaagaaaatcaccaatatcttctcgaaaaaaatcttgtgtaaaa
gatcgttgcgtgagctcaagcttcttcagttcttccgcggccacaagaacattacttgtc
tatatgacttggatatcgtgcccaacccgctcacgggagactttaacgaaatataccttt
tacgaggaactcatggaatgcgacatgcaccagataatacggtcaggccaggctttgaca
gactcccactaccagtccttcatctaccaggtgttgtgtgggctcaagtatatccactcg
gcagatgttcttcatcgtgatttgaagccgggaaacttgctcgtcaacgccgattgcgag
ctcaagatctgcgactttgggttggcccgcggatttctggaagaccccgagcagaacgct
gggttcatgacagagtacgtggctaccaggtggtaccgggctccggagatcatgctctct
ttcaccaactactccaaggcaattgatatctggtcggcaggctgtatcttggccgagctt
cttggtggaaaaccactcttccgcggcaaagattatgtcgaccaactcaaccaaatcttg
ttggttcttggaactcccgatgaacccaccctcaccaaaatcggttctgttcgagcacaa
aactacgtgagatctctcccggccatgcgcaaggttccttataacgaaatctttcccaac
gccaacccattggctctcgatctcttggaaaaaatgttgacattggacccattcaaaaga
atcactgtggaagaagctttggaacatccatacttgtcggtgtggcacgatccccaggac
gagcctcggtgccaggtcaagtttgatttcaagtcgtttgaaaaagccgacgatatgaat
atcatgaaacggttgatcatggaagaggtgaaaaatttcagagattttgtaagaagaccc
atcgaagaacagcaacagatccaattgcaaatgcagatgcaacaacaagatatccagcag
caccatcaaaaccacgtccagatgggactcccaaatcctctcgcagccaaccaatacagt
gatgtacttaacccatactcgtctcattccaactcgtcgctgaacaacaacgccgaggtc
aacaccgacccatcccagatgaacaacgacctacaattctacgaatcggttcccaaacca
caagagcttcccgagttccccttctcgcctcatcatccgtcacacgacgttcacaagccc
agtcccatggacgacgacttgtttcgcttggaggaggagttggggttcggtcttgacggc
ggtatgtataataatatatag

DBGET integrated database retrieval system