KEGG   Meyerozyma guilliermondii: PGUG_01405Help
Entry
PGUG_01405        CDS       T01150                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00010  Glycolysis / Gluconeogenesis
pgu00051  Fructose and mannose metabolism
pgu00562  Inositol phosphate metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01200  Carbon metabolism
pgu01230  Biosynthesis of amino acids
Module
pgu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pgu_M00002  Glycolysis, core module involving three-carbon compounds
pgu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_01405
   00051 Fructose and mannose metabolism
    PGUG_01405
   00562 Inositol phosphate metabolism
    PGUG_01405
Enzymes [BR:pgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PGUG_01405
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PGUG_01405
  Exosomal proteins of bladder cancer cells
   PGUG_01405
  Exosomal proteins of melanoma cells
   PGUG_01405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5128319
NCBI-ProteinID: XP_001485734
UniProt: A5DDQ4
AA seq 248 aa AA seqDB search
MSRQFFVGGNFKMNGTKESITKIVDGLNKSDLPENVEVVIAPPAPYLALAVSENKQKTVE
VGAQNVFDKASGAYTGEISPEQVKDLGAKWTLTGHSERRTIIKESDDFIAAKTKFALEQG
LKVILCIGETLDERKANVTLDVCARQLDAVSKIVSDWSNIVVAYEPVWAIGTGLAATPDD
AQETHKGIRAHLEKTIGADQAKKVRILYGGSVNGKNAGEFKDKPDVDGFLVGGASLKPEF
VDIIKSRL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcaatttttcgtaggtggaaactttaaaatgaatggtaccaaggagtccatt
accaaaatcgtggacggcttgaacaaatcagaccttccagaaaatgtggaagtggtaatt
gctcctccagctccatatcttgcattggccgtttctgaaaataagcaaaaaactgttgaa
gttggagcccaaaatgtgttcgacaaagcttctggtgcctacactggagagatttctcct
gaacaagtcaaggatttgggagctaaatggacattgactggtcactctgagagaagaacc
attatcaaggaatctgatgattttatcgctgccaagaccaagtttgccttggaacaaggc
ttgaaggttatcttgtgtatcggagagaccttggatgagagaaaggccaacgtgactttg
gatgtttgtgccagacaattggatgccgtttccaagattgtcagcgactggtccaacata
gttgtcgcttacgagccagtgtgggcaattggaaccggattggctgccactcctgacgat
gcccaagagacccacaagggaatcagagctcacttggaaaagaccattggtgctgaccaa
gctaagaaggtgagaatcttgtacggaggatcggttaacggcaagaacgctggtgagttc
aaagacaaaccagatgtcgatggatttttggttggaggagcctcgttgaagcctgagttt
gtggacattatcaagtccagattgtag

DBGET integrated database retrieval system