KEGG   Meyerozyma guilliermondii: PGUG_01459Help
Entry
PGUG_01459        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 761 aa AA seqDB search
MWTPLTCRASNLPPVVRYTLRENLSCHVTECQGRAERQPSSPLCNPKVSTPLSISLMAYN
YNTNRHNSVGGSWQLPPPPPQPPVSSGAYSDSPAMMNHDFRNPWFSGGRPQAQQNVAGQM
LMANSPTKTPQLPLLQTQVGQQPKRLSLVNQLPTTYEDETQNSGPFIHPPTRVDNPFNQY
YTNQDVTLDDRRMSVADGSYLKSGYNGFAEPGGGGGVAGAGIAPPYGQASFNNLRRSSLA
VGPFMDGGVAGYRKPGRSASVVQYQQYQQSVLEKQHSYFRLPAPRAKRVHSKLDLHPKIH
HIPKYRRASVNSVHISPVNALSIYLTETYRICQPKKFQYSKLTNPKRVLTKPLDPKYNNG
YDNEDSDYILYVNDVLGTEEGRKYIVLDLLGSGTFGQVVKCQNLTNQSVCAIKVIKSKPA
YMNQSLTEVRLLEFLNSNSDGNHFIRLLDTFMHKEHLCLVFELLASNLYELIKQNQFQGL
NMRLVKLLTKQLLESMAQLKSFQIIHCDLKPENILLCQPDKPDIKIIDFGSACFTHQTIY
SYIQSRFYRSPEVILGLPYTESIDMWSLGCIVGELFLGLPMFPGTSEYNQIWKIVDMLGY
PPRHMIDVGRNSTNFFHKVPASTPEGKHSYTIKSYDEYVQYLASTKGKEEQSQKEQKNKN
YFKHRLMKDIILNYKFSSKMTNTMIEKECQERLLLVDFLTKCLNMNPLERLTPQEALKHP
FVNDVLQPLTPTPQPESTQNHFAPRRASTLDNRIQAQYSRT
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgtggacaccgctcacgtgccgcgcctcaaacctacccccggttgtccgatacactctg
cgtgagaatctctcatgtcacgtgaccgaatgccagggtcgagctgaacgccaaccctct
tctccgctctgcaatcctaaagtgtcaacccccctgtccatctcgctgatggcgtacaat
tacaacaccaaccgtcacaattcggtaggaggcagctggcaacttcctccgccgccgcca
caacctccggtttcttcgggggcatactccgattctccggcgatgatgaatcacgatttt
cgaaacccatggttttccgggggtcggccccaggctcagcagaatgtagctggacagatg
ctgatggcgaatagtccgacgaaaacccctcagcttccattattacaaactcaagtgggc
cagcaacccaaacggctctccctcgtaaatcagttacccaccacttatgaagacgaaact
cagaattccggaccttttatacacccgccgacgagggtggacaatcccttcaatcaatac
tacacaaatcaagacgttaccttggacgaccgtcgaatgtcggttgctgatgggtcgtat
ctcaaatcgggctacaatggatttgcagaaccgggaggtggtggaggagttgctggtgca
ggcattgctccaccatatggtcaggcttcgttcaacaatcttcggcggtcgtcattggcc
gttggaccgtttatggatggaggtgttgctgggtaccgcaagcctggaagatctgcctct
gtggttcaatatcaacaatatcaacaaagtgtgctggaaaaacaacacagctacttcaga
ttacctgctcctcgtgccaaaagagtccattcgaaactagatttgcatcccaagattcac
cacatacccaagtaccgtcgagcctcggtcaattccgtccacatttcaccggtcaatgcc
ctttcgatttacttgaccgagacataccgcatctgccagcccaaaaaatttcagtactcc
aagctgacaaaccccaaaagagtgctcaccaaaccgctggatccaaagtacaataatggc
tacgataacgaagacagtgattatatcctctacgtcaacgatgttttgggcacggaggag
ggccgcaagtacattgtgttggacctcttgggctcggggacgtttggtcaggtggtaaag
tgccagaacttgaccaaccagtcggtgtgtgcaatcaaagtgatcaagtccaaacccgca
tacatgaaccaatctttaaccgaggtgcgactcctcgagtttctcaactccaacagtgat
ggtaaccactttattcgattacttgacactttcatgcacaaggaacatctctgtcttgtg
ttcgagttgctagcatctaatctttacgagctcatcaaacagaaccagttccaaggtctc
aatatgcggttagtgaaactcttgaccaagcagctattagaatccatggcccagctcaaa
agtttccagattattcattgcgatctaaaaccggaaaatatcctcttatgccagccagat
aaacccgatatcaaaatcatagatttcggttcggcttgcttcacacatcaaaccatctac
tcctacatccagtcacgattttaccggtctcctgaggtcatcttgggcctcccgtatact
gagtccatagatatgtggtccttgggttgcattgtgggagagttgtttctcggccttcca
atgtttcccggcacatctgagtacaatcagatatggaaaattgtcgacatgctcggatat
ccacctcgccatatgatcgatgttggtcgcaattctacaaactttttccacaaggtgcct
gcttctactccagaaggaaagcattcttacaccataaaatcttacgacgaatacgttcag
tatttggcatctacaaagggtaaagaagaacagagtcagaaggagcagaaaaataaaaac
tatttcaaacatcgtctgatgaaagatataatattgaactacaaattctcgtccaaaatg
acaaacacaatgattgaaaaggaatgtcaagaacggttattattggtcgatttcctcacc
aaatgtctcaatatgaacccccttgaaagactaacacctcaggaagcattaaagcatcca
tttgtgaatgacgtattgcagccattgaccccaactccacagccagaatccactcagaac
cactttgcacctcgtcgtgcaagcacccttgacaatcgtatacaagcacagtactcgcgt
acgtag

DBGET integrated database retrieval system