KEGG   Meyerozyma guilliermondii: PGUG_01527Help
Entry
PGUG_01527        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00480  Glutathione metabolism
pgu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PGUG_01527
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PGUG_01527
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PGUG_01527
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin SCO1-SenC DUF4174
Motif
Other DBs
NCBI-GeneID: 5128472
NCBI-ProteinID: XP_001485856
UniProt: A5DE26
AA seq 192 aa AA seqDB search
MIMITNTTAAHQSAHPYTSGYMMARIALPQIIMTSFYDLTPNDKTGKPYPFEELKGKVVL
IVNVASKCGFTPQYKELEELNKKYKDKGLQIIGFPCNQFGKQEPGTDEEIGQFCQLNYGV
TFPVLQKVDVNGDKASPVYKYLKEQKAGLLGLTRIKWNFEKFLIDKNGNVVERFSSLTKP
SSLASAIEPLLK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattatgataaccaataccactgcggcacaccagtcagcccacccgtacaccagcgga
tacatgatggctcgtatcgcactgccgcaaattatcatgacctcgttttacgatttgacc
cccaacgacaagactggcaaaccatacccctttgaggagctcaagggcaaggttgtgctt
attgtaaacgtagcttccaagtgtgggtttactcctcaatacaaagaattggaagaattg
aacaaaaagtacaaagacaaaggtcttcaaattattgggttcccatgtaatcaatttggc
aaacaagaaccaggaactgatgaggaaattggtcagttttgccagttgaactatggcgtt
actttccctgttttacaaaaagttgacgttaatggtgacaaggccagccccgtttacaaa
tatcttaaagaacaaaaggcgggacttttgggattgactagaatcaagtggaactttgaa
aagtttttaattgacaagaatggaaatgttgtggaaagattctcgtcgttgaccaaacct
tcgtcgttggcaagtgcaatcgagccattattgaagtga

DBGET integrated database retrieval system