KEGG   Meyerozyma guilliermondii: PGUG_01652Help
Entry
PGUG_01652        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_01652
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_01652
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 726 aa AA seqDB search
MANPGLNRFRGDAASFSPSQQPAMHHMLQQQQQQQAHMYAHYMYAAAPQMVPNYYMNPYM
MPNMPYDFSQYQGTYPYPAPQPQPYGAPPFSPTFSPANPYNVAPRHKVKLSKAAYAQKAA
DPNANFQPSAATVMALQQKAGAEREKEENEENGKENGENGKSENGQLDQNDQNEIGQNGQ
NTQPKNVPSQYPILFNCTQADLSLDHRRPLSTNQLRRLSHFLQSKPGPIYINHDPITIFN
HNDDTRTRSKENSAKSDVDLKTKDKLAGNWASVLLQSAPKKKRSVPASTSSSQQPSTTTT
TSNASIHPSPAPPAAASPEPIGSLVLRIMYQHVTVAPFKIRVKGLTNTGNICYMNAVLQV
LLYCEPFNRMLKAIETKTAASLGKSDTPLLDATIKFFEDMSEPLKKALSPDDFYMRLIAH
DKFSHLKWGQQEDAEEFLNLFLDGLREEFIAVVRGLTPEQVNRVLEHGGDETYRQNVKAA
VNMIQKKKDDNDEGWNEVAGTKKASAKRTVQVEPSPISMIFGGQFRSVLQVPKSKEAQSI
TLDPFLCVPLDISDDSITTIEDAFVRFGETEELAFKEVVAKKQTFIDQLPPILLIQLKRF
LYQLGENAGGIEKLKKKVAYSHTLTLPNECLSPALRKHAGAGSKTYRLLAVVYHHGVGAE
GGHYTCDVLRKLSLYDHEHESEGKMVDAEWIRIDDTHIEVVERDEVLEGSEDSTKNAYIL
MYQRSS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcccggcctgaaccgattccgaggcgacgccgcttcattttccccgagccaa
cagccggcaatgcaccatatgctgcaacagcagcagcagcagcaggctcacatgtacgcc
cactacatgtacgcagcagctcctcaaatggtgccgaattactatatgaacccatatatg
atgcccaatatgccatacgatttttctcagtatcaaggtacatatccatatccagcacca
cagccacagccttatggagccccaccgttttccccgactttttccccggcaaatccatac
aatgtggcacctagacataaggtgaaactgtcaaaagctgcatacgcacagaaggctgcc
gaccctaatgccaacttccagcccagcgccgccaccgtgatggctctccagcaaaaagcg
ggagctgagagagagaaggaagagaatgaagagaatggtaaggagaatggagagaatgga
aaaagtgagaatggtcaacttgaccaaaatgatcaaaatgaaattggccaaaatggccaa
aatacccagccaaaaaacgtcccctcgcaataccccatactatttaactgcacccaagcc
gacttgtcgctggaccaccgccggccactttccaccaaccagctgcgccgcttatcgcat
tttctccagtcaaaacccggtcccatctacataaaccacgaccctatcaccatcttcaat
cataatgacgatacccgtactcgcagcaaggaaaattccgccaagtcggacgtggacctg
aaaacgaaagacaagcttgctggtaactgggcgtcggtattgttgcaaagtgcacccaag
aaaaagcgttccgtacccgcctctacgtcctcctcgcaacaaccctcaacaaccactaca
acatcaaatgcctctattcacccatcacctgctccaccggctgctgcttctccagaacca
attggctcgcttgtgctccgcataatgtaccagcatgtaacggtagcaccgttcaaaatc
cgagtcaaagggctcacgaataccggcaacatttgctatatgaatgcggtgcttcaggtg
ctcctctactgtgagcctttcaaccgcatgttaaaggctatcgagacaaagacggcagcg
agtttaggcaaatctgacactcctcttttggacgctaccatcaagttctttgaagacatg
agtgagcctctgaaaaaagcattgtctccggacgacttctacatgcggttgattgcccac
gacaagttctctcacttgaaatggggccaacaggaagatgctgaagaatttctcaatctt
tttttggatggtcttcgcgaagaatttatagctgttgtgcgaggcttgacaccagaacag
gttaatagagttctcgagcatggaggagatgaaacatatcgccaaaacgtcaaggcggca
gtcaatatgattcagaagaaaaaagacgacaatgatgaagggtggaatgaagttgctggt
accaagaaagcttccgccaagcgcaccgtccaagtcgaaccatcgccaatctcgatgatt
tttggtggccagttccggtcggttttacaagttcccaagagtaaagaagcacagtctatc
acattggatccatttctgtgcgttcctctcgatatttctgatgatagcatcaccaccatc
gaagatgcttttgtcaggtttggagagactgaagaattggcattcaaagaggtggttgca
aagaaacaaacctttatcgatcaacttcctcctatcctactcatccagttaaaacgattc
ctgtaccagctaggagaaaatgctggaggcattgaaaaattgaaaaagaaagttgcatat
tctcataccctcactttacccaacgagtgtctttcgccggctctcagaaagcacgctgga
gcgggctccaagacataccggttgctggcggtggtataccatcatggagttggggccgaa
ggaggacattatacttgtgatgtgttgagaaagctgtcgttatacgatcacgagcacgag
tcggaaggtaagatggtggatgctgagtggatacggattgacgatactcatattgaagtt
gttgagagagatgaggtgttggaaggaagtgaagatagtaccaaaaacgcatatatcttg
atgtaccagcgaagttcatag

DBGET integrated database retrieval system