KEGG   Meyerozyma guilliermondii: PGUG_01690Help
Entry
PGUG_01690        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pgu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MRPLSTFNMKWYFLASMAAAAAVDNFAWGEAMVINDDSASPQNSGSFLDSVYGPLVAAGL
QQRLTPKNNEPEAIEAQLLAQLQEVTDFASLEVLMSQMKKKSRTNPEQIHEDRFYEKSHE
AYLKYQTKLNLPDDDEVSDIVDGRNLFGGIVTFGGFPHFNCFDDKHLDKKIDVAIVGAPF
DTGVLFRPGARFGPDAIRLAGKRLGGLTPERKPTTKNPYDLRTHNVSIVDCGDVPMTPFD
NRIALNQLYRGERKIHKHDSSLGPKIITMGGDHTITLMALRSAYEKYGKVSVLHFDSHID
TWDPKVLGGGITHYMALNHGTFLHYAAEQGYLNEGQCLHVGLRAPYIDAKYDHEHDAACG
FHSITARDIDSMGIHGIVNKIKSTVKDTPVYISVDIDVLDPANAPGTGTMEIGGWTGREL
LSVLDGLKGINLVGADVVEVSPPYDSNSDITSLAATAVIDSYLWLLVDN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgccccctctccacattcaacatgaagtggtattttttggcttcaatggcagcagct
gctgctgtagataattttgcctggggcgaagcaatggtaattaatgacgactcggcgtca
ccacaaaattcgggttcgtttcttgattcggtatatggaccgttagtagcggctggtctg
cagcagcgattgacccccaaaaacaacgagccagaagcgatagaggctcaattgctcgca
cagttacaggaagtgaccgattttgcctctttggaagttttgatgtcgcaaatgaagaaa
aaaagtcggactaatccagaacagattcacgaagacaggttctatgagaagagccatgaa
gcttacctcaagtaccaaacgaaattgaaccttcccgacgacgatgaagtttcggacatt
gttgatgggcgcaatttgttcggtggaatcgtcacttttggtgggtttcctcactttaac
tgctttgacgataagcatcttgataagaaaattgatgtggcaattgtgggcgctcccttt
gacacaggagtcctgtttcgtcccggagctcggttcggacccgatgctatacggctggca
ggcaagcggctcggaggacttacgccggaacgtaaaccgaccacgaaaaatccatacgat
cttcgcacccacaacgtcagtattgttgactgtggagatgtgcctatgactccttttgac
aaccgaattgccttgaatcagttgtaccgtggcgagcgaaagatccataagcacgattcg
tcgctgggacccaaaataatcaccatgggcggagaccataccatcactctcatggcactt
cggtcagcatacgaaaagtacggaaaggttagcgttttgcactttgactcgcacatcgat
acgtgggaccccaaagtgttgggaggcggaatcacccattatatggcacttaaccatgga
acttttcttcactatgctgcggaacaaggctacttgaacgaaggtcaatgtctccacgta
ggcttgcgggcaccatatattgatgccaaatacgaccacgagcacgatgccgcttgtggg
ttccactcaattaccgccagggacatcgattctatgggaatacatggtatcgtcaacaag
attaaatccaccgttaaagacactccggtttatatttctgtggatatcgatgttctcgac
ccagcaaatgctcctggtacaggaaccatggagatcggcgggtggacgggccgggagctt
ttgagtgttctagatggactcaaaggtatcaatttggtgggggctgatgtggtggaggtg
agtcctccatacgacagtaatagcgatattactagtttggctgctaccgctgttatcgac
tcttacttgtggcttttggtagataattag

DBGET integrated database retrieval system