KEGG   Meyerozyma guilliermondii: PGUG_01710Help
Entry
PGUG_01710        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00860  Porphyrin and chlorophyll metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PGUG_01710
Enzymes [BR:pgu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PGUG_01710
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     PGUG_01710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Thi4 Pyr_redox DAO Mqo Pyr_redox_2 NAD_binding_9
Motif
Other DBs
NCBI-GeneID: 5128110
NCBI-ProteinID: XP_001486039
UniProt: A5DEK9
AA seq 531 aa AA seqDB search
MAPTKLPQNGRVGVIGAGISGLSYAYFLKKLRPDVKITVFEKSNQPGGWIRTKKLTNNQQ
NIILEKGPRTLRGVSDGTLLIIDILKQLNIENELQVMKSTSIANRKYIVGQDHQLVQVPG
SVKSFLKFLSSGVVSGIPTGAIKEIFQKVSSTGKDESIESFIKRRFKSTALTDNIMSAVL
HGIYAGDVSKLSVNSVVPGLVALEKDHGSIVKGALKNMYKALTAKKHQKDLETSLKVYEQ
RISPQADLRGLEAKLKGYPIVKLRNGLQELPLALSSYLQSQANVDILYDTTIDNVDFKQC
TIKTSNGTNKYDHIRSTINVKALASLAQKLALTEKFSKIEYVSIFMANIYSRERLVPRDQ
EGFGFLVPKSVHNQERLLGIIFDSDIEKNSHSFEGQPEKFDGYSKITLMMGGHFFSDEIP
SNSVNLRAVKKCLQQYLGVDILQKKVILRDEANEKDTKVTLEGDDILISYNLHKDCIPQY
NVGYKAIKEKTELLLALEYKGTLSLGGMCFGKGIGVPDCVSNALDSAIDLS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaccaaactaccacaaaatggacgggtaggggtcattggggccggtatatct
ggtctttcgtatgcgtattttcttaagaagcttcgtccagacgtaaaaatcaccgttttc
gagaaatcgaaccagcctggaggatggatcagaaccaagaagctcacgaacaaccaacaa
aatatcatattggagaagggaccgaggacactaagaggcgtgagtgatggaacattgctc
ataatagacatactcaagcaactaaacatagaaaatgaacttcaagtcatgaaatcgact
tcgattgcaaacagaaaatatatcgtgggacaagatcaccaacttgtgcaagttccgggc
tcggtcaaatcctttttgaagtttttgtcgagcggtgttgtgtctgggatccccactgga
gcaattaaagagatctttcaaaaggtttcatcgacaggaaaagacgagagtatagaaagc
ttcattaaacgtcggtttaaatccaccgcattgactgataacataatgagtgctgttcta
cacggaatatacgccggggacgtatccaaacttagcgtgaacagtgtggttcccggactt
gtggcacttgaaaaagatcacggctcaatcgtgaaaggtgcactcaagaacatgtacaaa
gcacttactgcaaaaaagcaccaaaaggacctagaaaccagtttgaaggtgtatgagcag
cgtatctcgccccaggctgaccttcgtggcttggaagctaaactcaaaggatatccaatt
gtcaaacttaggaatggactacaagagctaccacttgcgttatcgtcgtacttacagtca
caagccaacgtggacattttatacgatacgacaattgataacgtggactttaagcagtgt
accataaagacgagtaatggaactaacaaatatgatcatatacgatcaacgatcaacgtc
aaggctttggcatcactagctcagaaactggctcttaccgaaaaattttccaaaattgag
tatgttagtatctttatggcaaacatttactcccgagaaagacttgtacccagagatcag
gagggatttgggttcttggtcccaaagtcagttcataatcaagagagacttcttggcata
atatttgattcagatatcgaaaagaattcccacagctttgagggacaaccagagaagttt
gatggttacagcaagataacattgatgatgggaggacattttttcagcgacgaaattccc
tccaactctgtcaatttaagagccgtgaaaaagtgcctacaacaatatctcggggtggat
atcctgcaaaaaaaagtaattttaagagacgaggcaaatgaaaaagacaccaaggttact
ctagaaggtgatgatattcttatctcgtacaatttgcataaagactgcattcctcagtat
aatgtggggtataaggctatcaaagagaaaacagaattattgctcgctctggagtataaa
ggtactttatcgctcgggggaatgtgttttggcaagggcataggtgtacctgactgtgtg
agcaatgccttagacagtgctattgatcttagctaa

DBGET integrated database retrieval system