KEGG   Meyerozyma guilliermondii: PGUG_01720Help
Entry
PGUG_01720        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PGUG_01720
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     PGUG_01720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MYLSMSQEHLLYEPSPAVSVRIVLDGLAIMQDHAALLYNNEPDFDKLIFSYCRPYGGKSD
KIPQKIRYVDVLWCEHEPEVASNCVNLTFVHQHTIVQMQVHVDIADFSDHDNDISSYILS
HAYTNGLMKPSIYVLLNPHGGTGLARSIYDKHIEKVLKAANADITFVETTYLGHATDLMR
ELDVSKYDIIVCCSGDGIPFEVINGFYSRPDKGVSAFNKLAVTQLPCGSGNALSLSTHGT
DNAFDATVAMLKSQRTKLDLMAVTQGTGENATTRLSFLSQCYGMIADADIGTEHLRWIGS
IRFELGVLQKVLLRTTYPCELWIDYATDTKQQLREHYDDHVGVVAPISEILSLALNLKYP
GLDSPPPTEWVKVDDQVASTLNQVYVGNLPYVSKGAQFFPAALPNDHLMDLIMTTSKSSI
IDTFSAILAVEKGTHVHNSKVFHAKIRGYRLIPKINSKGHYISVDGESFPFEPYQVEVFP
GILTSLLTDSKFVATSYTS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtacctgagcatgtcacaagaacacttgttatacgagccgagccccgctgtgtcggtg
cggattgttctggatggcttggccatcatgcaagaccatgcggctttgctgtacaataat
gagccagatttcgacaaactgatcttttcatactgtcggccttatggaggaaaaagtgac
aagattccgcaaaaaatacgatacgtagatgttttgtggtgtgagcatgaaccggaggtg
gcgtcaaattgcgtcaacttgacttttgtacaccaacatacaattgttcagatgcaagtt
catgtagatattgccgattttagcgatcacgataatgacatttcgtcgtatattttgtct
catgcatacactaatggcctcatgaaaccttccatatacgtgcttctcaatcctcatggt
ggtacgggtctggcaagatccatttacgacaagcatattgaaaaggttttaaaggctgca
aatgcagacataacttttgtagaaaccacctacctgggccatgccaccgacttgatgcga
gaacttgatgttagtaagtacgatattattgtgtgttgctcgggagatggtataccgttt
gaggtaatcaatgggttttattctcggcccgacaaaggagtttctgcatttaacaagttg
gcagttacccagcttccttgtgggtctggtaatgccttgagtcttagcacacatgggacg
gacaatgcttttgatgctactgttgccatgctaaagtcgcagcgtacgaaactcgacttg
atggctgttacacaaggtacaggcgaaaatgccactacaaggctttcgttcttgtcacaa
tgctatggaatgattgctgatgcagatataggtacggagcacttgcggtggattggctct
attcggttcgaacttggggtactacaaaaggtgcttctgaggaccacttatccttgtgag
ctctggattgactatgctacagataccaagcagcaactacgtgagcactacgatgaccat
gtgggagttgtggctccaatctcagaaatcctgtcgctggctttgaacttgaagtatcct
ggtttagactcaccacctcccaccgaatgggtcaaagtcgacgaccaagttgcatccacc
ttgaaccaagtctatgttggaaatctcccgtatgtttccaagggagcgcaattcttccct
gccgctcttcccaatgatcacctcatggatctcatcatgaccacctccaaatcatccatc
atagatacgttttccgccatactagcggtcgaaaaaggaactcatgtgcataatagcaag
gtattccacgccaagattcggggataccgactcataccgaaaatcaatagcaagggccat
tacatttctgtcgatggtgagagctttccattcgagccatatcaagtcgaagtctttcca
ggtattcttaccagtttattgacagattccaagtttgtggccaccagttatacatcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system