KEGG   Meyerozyma guilliermondii: PGUG_01778Help
Entry
PGUG_01778        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    PGUG_01778
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     PGUG_01778
Protein kinases [BR:pgu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   PGUG_01778
Messenger RNA biogenesis [BR:pgu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     PGUG_01778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 350 aa AA seqDB search
MTSMEYSETSKHSLNDISLEEMAQSQQQHNIYVGGQETHGAPDQPSIDAKNLSTSLTKST
SRHLHKDTTTKGKYTLNDFQILRTLGTGSFGRVHLARSIHNGRFYAMKTLKKERVVNMKQ
VEHTNDERRMLKLAQHPFIIRMWGTFQDCHNLFMIMDYIEGGELFSLLRKSQRFPTPVAK
FYAAEVFLAIEYLHKLDIIYRDLKPENILLDKNGHIKLTDFGFAKEVADVTYTLCGTPDY
IAPEVVATKPYNKSVDWWSFGILIFEMLTGYTPFYDPTPMKTYENILNGTITYPDYLPPD
ILDLLQKLIVKDLSQRLGNLQNGSDDIKNHPWFKEVIWERLLSRDIENPL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgatggaatactcagagactagcaaacattcgttaaacgatatctcgctcgag
gagatggcccagagccaacaacaacataatatttatgttggtggacaggagacacacgga
gcgcctgatcaacctagtattgatgctaaaaatctgtctacgtcgttaactaaaagtaca
tctcgccatcttcacaaagacaccaccacgaagggcaagtataccttgaatgactttcaa
attctaagaacattgggaaccggatcattcgggcgagtgcatttggccaggtcaatacat
aacggtcgattttacgctatgaaaaccctcaagaaggagagagtagtcaacatgaagcaa
gtggaacatactaacgatgaaagaagaatgttgaagcttgcacagcatccattcattatt
cgaatgtggggaacattccaagattgccacaatctcttcatgataatggactacatagaa
ggtggtgagttgttctctttgctacgcaagtctcagcgatttccgacaccagtagcaaag
ttctacgcagctgaagtatttctcgccatagaatatttgcacaagctcgacataatctac
cgtgatttgaaaccagaaaacattcttttggataaaaatggccacataaagttaaccgat
tttggtttcgccaaagaagtggctgatgtaacatacactttatgtggtactccagattat
attgctccagaggtggttgctacaaagccgtataataaatccgttgattggtggtcgttc
ggaatattgatctttgagatgctaactggatacaccccgttttatgatccaacgccaatg
aaaacatatgagaatattttaaacggtacaatcacttaccctgactacttacctcctgac
attctagatttgttgcaaaagttgatcgtcaaggacttgtcccaacgattgggaaatttg
caaaatggctcggacgacatcaagaatcatccatggttcaaggaagtgatatgggaacgt
ctattgtcgagagatatcgaaaaccccttatga

DBGET integrated database retrieval system