KEGG   Meyerozyma guilliermondii: PGUG_02003Help
Entry
PGUG_02003        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00600  Sphingolipid metabolism
pgu01100  Metabolic pathways
Module
pgu_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PGUG_02003
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     PGUG_02003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 5127971
NCBI-ProteinID: XP_001486332
UniProt: A5DFF2
AA seq 367 aa AA seqDB search
MASPNTKGMAVAEAVPGKVTTSRLKPSKMSRKGPYHTSFVATVERNQIPISQVLLACLYM
LHIFYPKLLPITTKFIHLQYKIGTGSDGAPLYDIGIDDAYYVAHWVITLTFLRAFLMQWV
FGPFASMSNKIKTKGARTRFCEQSWLVTYYTFSFAYGIYLYVHSPYYMNIDHLYLHWPNH
NMTAGFKKYYLISMGFWFQQVFVLHIEKRRKDHYQMLSHHIITCCLMVGSYNYYYFRIGH
IILMIMDSVDILFSGAKILRYLGYSKLCDLMFFCFLMSWIILRHGLYNYLYYHAWTKASS
LMPDAKCIPGVLQRRCWTNTVINTFLGLLGGLQIITIVWMYLIAKVAYRVVTGQGAEDVR
SDESDEE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccaatactaagggaatggcagtggcagaggcagtgcctggaaaagtcacg
acaagtcgcctgaaaccgtccaaaatgtcacgaaagggaccgtatcacacgtcatttgtg
gcgacagttgaacgtaatcagatcccaatttcccaggttttgcttgcatgcttgtacatg
cttcatatcttctaccccaaactcttacccatcaccacaaagttcatccatctccaatac
aagatcggaacggggtccgacggcgctccgctctacgatattggcatcgacgacgcctac
tatgtggctcattgggtgatcaccctcacatttttacgagccttcttgatgcaatgggta
tttggaccatttgctagtatgtccaacaagatcaaaaccaagggagcccgcacgaggttc
tgtgaacagagttggttggttacctattatacgttttcgttcgcatatggcatctatttg
tatgtccactcgccatactacatgaatatcgatcacctttatcttcattggcccaaccac
aatatgactgcgggattcaaaaaatactacctcatctccatggggttctggttccaacag
gtatttgttcttcacatcgaaaaacgcagaaaagatcactatcaaatgttaagccatcac
atcataacttgttgccttatggtcggctcctataattactactacttccgtatcggccac
ataattctcatgatcatggattcagtcgatattctcttctcgggagccaaaatcttacgg
tacctcggctactccaagctttgtgacttgatgttcttctgtttccttatgtcgtggatc
atcttgcggcacggcttgtacaactatctttactatcacgcatggacaaaggcttcatcg
ctcatgcccgacgccaaatgcatccctggagtgttgcaaaggcggtgttggaccaatact
gtgatcaacacgtttttgggccttttgggagggcttcagatcatcaccattgtttggatg
tatttaatcgcaaaggtcgcctatagagtagttactggccagggtgcagaagacgtccgt
agtgatgagtctgatgaagagtag

DBGET integrated database retrieval system