KEGG   Meyerozyma guilliermondii: PGUG_02003Help
Entry
PGUG_02003        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pgu00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MASPNTKGMAVAEAVPGKVTTSRLKPSKMSRKGPYHTSFVATVERNQIPISQVLLACLYM
LHIFYPKLLPITTKFIHLQYKIGTGSDGAPLYDIGIDDAYYVAHWVITLTFLRAFLMQWV
FGPFASMSNKIKTKGARTRFCEQSWLVTYYTFSFAYGIYLYVHSPYYMNIDHLYLHWPNH
NMTAGFKKYYLISMGFWFQQVFVLHIEKRRKDHYQMLSHHIITCCLMVGSYNYYYFRIGH
IILMIMDSVDILFSGAKILRYLGYSKLCDLMFFCFLMSWIILRHGLYNYLYYHAWTKASS
LMPDAKCIPGVLQRRCWTNTVINTFLGLLGGLQIITIVWMYLIAKVAYRVVTGQGAEDVR
SDESDEE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccaatactaagggaatggcagtggcagaggcagtgcctggaaaagtcacg
acaagtcgcctgaaaccgtccaaaatgtcacgaaagggaccgtatcacacgtcatttgtg
gcgacagttgaacgtaatcagatcccaatttcccaggttttgcttgcatgcttgtacatg
cttcatatcttctaccccaaactcttacccatcaccacaaagttcatccatctccaatac
aagatcggaacggggtccgacggcgctccgctctacgatattggcatcgacgacgcctac
tatgtggctcattgggtgatcaccctcacatttttacgagccttcttgatgcaatgggta
tttggaccatttgctagtatgtccaacaagatcaaaaccaagggagcccgcacgaggttc
tgtgaacagagttggttggttacctattatacgttttcgttcgcatatggcatctatttg
tatgtccactcgccatactacatgaatatcgatcacctttatcttcattggcccaaccac
aatatgactgcgggattcaaaaaatactacctcatctccatggggttctggttccaacag
gtatttgttcttcacatcgaaaaacgcagaaaagatcactatcaaatgttaagccatcac
atcataacttgttgccttatggtcggctcctataattactactacttccgtatcggccac
ataattctcatgatcatggattcagtcgatattctcttctcgggagccaaaatcttacgg
tacctcggctactccaagctttgtgacttgatgttcttctgtttccttatgtcgtggatc
atcttgcggcacggcttgtacaactatctttactatcacgcatggacaaaggcttcatcg
ctcatgcccgacgccaaatgcatccctggagtgttgcaaaggcggtgttggaccaatact
gtgatcaacacgtttttgggccttttgggagggcttcagatcatcaccattgtttggatg
tatttaatcgcaaaggtcgcctatagagtagttactggccagggtgcagaagacgtccgt
agtgatgagtctgatgaagagtag

DBGET integrated database retrieval system