KEGG   Meyerozyma guilliermondii: PGUG_02118Help
Entry
PGUG_02118        CDS       T01150                                 

Definition
similar to asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGUG_02118
Enzymes [BR:pgu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PGUG_02118
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C44
   PGUG_02118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 573 aa AA seqDB search
MCGIFAAFRQPEVDKYKETALSNSKMIRHRGPDWSGNVIRNSTILCHERLAIVGLDSGAQ
PIKSDDDNYFLAVNGEIYNHIQLRDQFKDYKFHSLSDCEPIIPLFEKYDVDAPKYLDGMF
AWVLYDKKKDRIVAARDPIGITTLYMGKSSKNPKTRYFASELKCLLQDCDEVVAFPPGHV
YDSDTDKLTRYFEPTWWDETKVPQKNVDYKEVRETLEMAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKAAKSFSSHGIDANKELSGVDESGSLHSSGWNRLHSFAIGLPGAPDLI
AAEKVAHFIGTIHHSHTFTLQEGLDALNDVILHLETYDVTTIRASTPMYLLSRKIKAQGV
KMVLSGEGSDEIFGGYLYFANAPNASDFHQECVKRVKNLHYADCLRANKSTMAWGVEARV
PFLDKQFLEVCMNINPEDKLIKPKEGKIEKYALRKAFDTSSEPDVKPYLPEEILWRQKEQ
FSDGVGYSWIDGLKDAAEAAVSDEELATPKPEWGDDIPTTKEAYWYRCKFDDIFKEKSAI
AATTVMRWIPKAEWGCHADPSGRYANIHEAKVE
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattttcgctgctttcaggcagcccgaagtggacaagtacaaagagactgct
ctcagcaactccaagatgattcgtcatcgtggtcctgactggtctggtaacgtcattaga
aactccaccattctttgccatgaacgtttggctattgttggtttggattctggtgcccaa
cctatcaagtctgacgacgacaactacttcttggccgtcaatggtgagatctacaaccat
attcagttaagagatcaatttaaagactacaaattccactcgttatctgactgtgaacct
atcattcctttgtttgaaaagtacgatgtggatgctccaaagtacttggacggtatgttt
gcgtgggtgctctacgacaagaagaaggatagaatcgtggctgctagagaccctattggt
atcaccaccttgtacatgggtaaaagctccaaaaacccaaaaaccagatactttgcctcc
gagctcaaatgtctcttgcaagactgtgatgaagttgttgccttcccccctggtcatgtt
tatgactctgacaccgacaagctcaccagatactttgaaccaacttggtgggatgaaacc
aaggtgccacaaaagaatgtagactacaaagaagtcagagaaactcttgaaatggccgtc
agaaagagattgatggcagaggtaccttatggagttctcttgtctggtggtttggactca
tcgttgattgcctctatcgctgctcgtgaaactgaaaaggcagccaagtctttcagtagc
cacggaatcgacgccaacaaggaattatcgggtgttgatgagtctggttctttgcacagc
agcggatggaacagattgcactcttttgccattggtttgcccggtgctccggatttaatt
gctgctgaaaaggtggctcattttattggtaccattcaccactctcataccttcactctt
caagaaggtttggacgctcttaacgatgtgattctccaccttgaaacctacgatgtgacc
accatcagagcatctactcctatgtacttgttgtcgagaaagatcaaggctcaaggtgtc
aagatggtgttatctggagaaggatctgatgagatttttggcggatacctttactttgcc
aatgctccaaacgccagcgattttcaccaggaatgtgttaagcgtgtgaagaacttacat
tacgctgattgcttgcgtgctaacaagtctactatggcttggggtgtggaggctagagtg
ccatttttggacaagcaattcctcgaggtttgcatgaacatcaaccctgaggataagttg
ataaaacctaaggagggcaagatcgaaaaatacgccttgagaaaggcatttgatacttct
tccgagccagacgtcaaaccttacttgccagaagagattttgtggagacaaaaagaacaa
ttttcagacggtgttggttactcgtggattgatggcttgaaggatgccgcagaagctgct
gtcagtgacgaagagcttgccacacctaaaccagaatggggcgatgacattccaaccaca
aaggaagcctactggtatagatgcaaattcgacgatatcttcaaggaaaaatctgccatt
gcagccaccactgtcatgagatggattccaaaggctgaatggggatgtcacgcagaccca
tcaggaagatacgccaacattcatgaagccaaggttgaatag

DBGET integrated database retrieval system