KEGG   Meyerozyma guilliermondii: PGUG_02147Help
Entry
PGUG_02147        CDS       T01150                                 

Definition
calcineurin subunit B
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pgu  Meyerozyma guilliermondii
Brite
Protein phosphatases and associated proteins [BR:pgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PGUG_02147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 174 aa AA seqDB search
MGQASSHVLDSLMEGTNFDRDEIDRLRKRFMKLDSDGSGTIDKQEFLAIPGILSNPLASR
LMDVFDEDGSGTIDFQEFITGLSAFSGKTSKVDKLKFAFKIYDIDRDGFIGNGELFIVMK
MMVGKNLQDEELQQIVDKTIMEADEDGDGRLDFEEFKKAVDSKSVASALTLNMF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggccaggcgtcatctcatgtgttagatagccttatggagggcacgaacttcgaccgt
gacgagatagatcgtctacggaaacggtttatgaagcttgatagcgatggttctggcacc
atagacaagcaagaatttttggcaattccaggaatcctgtcaaatcctttggcatcaaga
ttaatggatgtgttcgatgaagatggaagcgggacaatcgactttcaagagttcataaca
gggctttctgcattcagcggaaaaacgtccaaagttgataagctcaaatttgctttcaag
atttacgatattgaccgtgatggttttattggcaatggagagttgtttattgtgatgaag
atgatggtgggtaaaaacctacaggacgaagagcttcagcaaatagttgacaagactatc
atggaagcagatgaagatggtgacggacgtcttgattttgaagaattcaagaaggcagtt
gattctaagtcagtggcttctgcattgacactcaacatgttttaa

DBGET integrated database retrieval system