KEGG   Meyerozyma guilliermondii: PGUG_02164Help
Entry
PGUG_02164        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGUG_02164
   01210 2-Oxocarboxylic acid metabolism
    PGUG_02164
   01230 Biosynthesis of amino acids
    PGUG_02164
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PGUG_02164
Enzymes [BR:pgu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     PGUG_02164
Amino acid related enzymes [BR:pgu01007]
 Aminotransferase (transaminase)
  Class I
   PGUG_02164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MRTVRGATNLVTKVFQRCISFKPAPPLHAKDLNQLTLEAKYAVRGKIPIRADELRSKLEQ
DPQSFTFDRIISANIGNPQQLDQKPLTWYRQVLSILQYPKLLEVDNFFPADVVERAKSIL
NSVGSVGAYSHSQGDPHIRESVAEFISKRDGFKSNPDNIFLTAGASAAVSYLLDILSTSE
KSGFLIPIPQYPLYTATIALNNAVPVGYFLNEDQNWATDPAQIRDLIQQNKEKGIHIKAL
VVINPGNPTGAILSKEDISELINIAAEHGIVLIADEVYQNNVFEREFISVRKVLYEMRQS
NPELYENVQVASLHSTSKGVSGECGQRGGYMELVGFTKEVKDVVFKLASINLCSVVSGQA
LVELMVNPPKKGDPSYELYHKETSGIHNDLRERSQKLHAAFNNMEDITCNKPMGAMYLFP
KLNFSQEKYEKLFQKAHEMELTVDELYCTALLEKTGICCIPGNGFGQVQGTYHLRTTFLA
PGNDWIENWSKFHKEFVKTYSQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagaactgttcgtggagctacgaatctagtaaccaaagttttccagagatgcatttcg
ttcaaaccggcacctccacttcatgctaaggatttgaaccagctgactttggaagcgaaa
tatgccgttcgtggaaagattcccattcgtgccgatgaacttcggtccaaattggaacag
gatcctcagagctttacgtttgatcgtataattagtgctaacatcggtaatccacaacag
ctagaccaaaaaccattgacgtggtaccgccaagtattgtctattcttcaatatcctaaa
ttgctcgaagtggacaacttcttccccgcagatgttgttgagagggctaagtcgattctc
aacagtgtgggttctgtgggagcatattctcactcacaaggtgacccccatattcgtgaa
tcagtcgccgagtttatttccaagcgggatggcttcaaatctaatcccgataacatcttc
ttgaccgccggtgcgtcagcggctgtatcttatttactcgacatcttgtctacgagtgaa
aaatcgggatttttgattccaattcctcagtatccgctttatactgctaccattgccttg
aataatgcggttcctgtgggatactttcttaatgaagaccagaattgggccactgatccg
gctcaaattagagacttgattcaacaaaacaaggaaaaaggtatacacataaaagcattg
gtggtgatcaacccgggaaatccaaccggtgccatactctccaaagaagatatttctgaa
ctcatcaatattgctgctgaacatggcatcgttttgattgccgatgaagtgtaccaaaat
aatgtctttgagagagaattcatatctgtcagaaaggtgctctacgaaatgcgtcaatct
aatcctgaattgtacgaaaatgttcaagttgcttctttacactccacttctaaaggtgtt
agtggtgagtgtggtcaaagaggaggatacatggaacttgttggatttaccaaggaagtt
aaagatgtcgttttcaagttggcttccatcaacttgtgttctgtcgtttcaggtcaggct
ttagtagaacttatggtcaatcctccaaagaaaggtgacccatcttacgaactttaccac
aaggaaacctctggaatccacaacgacttgagagaaagatcgcaaaaattgcatgctgcc
ttcaacaacatggaagacatcacttgtaacaaaccaatgggagcaatgtatcttttccca
aagttgaactttagccaagagaagtatgaaaagctttttcaaaaagctcacgaaatggag
cttacagtggatgaactttactgcacagcattgttagagaagactggaatttgctgcatt
ccaggaaatggctttggacaagtccagggcacgtatcacctcagaactacatttttggca
ccaggaaacgactggatagaaaattggtccaaatttcataaagagttcgtaaagacttac
agccagtaa

DBGET integrated database retrieval system