KEGG   Meyerozyma guilliermondii: PGUG_02164Help
Entry
PGUG_02164        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pgu01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:pgu01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pgu01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pgu00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 502 aa AA seqDB search
MRTVRGATNLVTKVFQRCISFKPAPPLHAKDLNQLTLEAKYAVRGKIPIRADELRSKLEQ
DPQSFTFDRIISANIGNPQQLDQKPLTWYRQVLSILQYPKLLEVDNFFPADVVERAKSIL
NSVGSVGAYSHSQGDPHIRESVAEFISKRDGFKSNPDNIFLTAGASAAVSYLLDILSTSE
KSGFLIPIPQYPLYTATIALNNAVPVGYFLNEDQNWATDPAQIRDLIQQNKEKGIHIKAL
VVINPGNPTGAILSKEDISELINIAAEHGIVLIADEVYQNNVFEREFISVRKVLYEMRQS
NPELYENVQVASLHSTSKGVSGECGQRGGYMELVGFTKEVKDVVFKLASINLCSVVSGQA
LVELMVNPPKKGDPSYELYHKETSGIHNDLRERSQKLHAAFNNMEDITCNKPMGAMYLFP
KLNFSQEKYEKLFQKAHEMELTVDELYCTALLEKTGICCIPGNGFGQVQGTYHLRTTFLA
PGNDWIENWSKFHKEFVKTYSQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagaactgttcgtggagctacgaatctagtaaccaaagttttccagagatgcatttcg
ttcaaaccggcacctccacttcatgctaaggatttgaaccagctgactttggaagcgaaa
tatgccgttcgtggaaagattcccattcgtgccgatgaacttcggtccaaattggaacag
gatcctcagagctttacgtttgatcgtataattagtgctaacatcggtaatccacaacag
ctagaccaaaaaccattgacgtggtaccgccaagtattgtctattcttcaatatcctaaa
ttgctcgaagtggacaacttcttccccgcagatgttgttgagagggctaagtcgattctc
aacagtgtgggttctgtgggagcatattctcactcacaaggtgacccccatattcgtgaa
tcagtcgccgagtttatttccaagcgggatggcttcaaatctaatcccgataacatcttc
ttgaccgccggtgcgtcagcggctgtatcttatttactcgacatcttgtctacgagtgaa
aaatcgggatttttgattccaattcctcagtatccgctttatactgctaccattgccttg
aataatgcggttcctgtgggatactttcttaatgaagaccagaattgggccactgatccg
gctcaaattagagacttgattcaacaaaacaaggaaaaaggtatacacataaaagcattg
gtggtgatcaacccgggaaatccaaccggtgccatactctccaaagaagatatttctgaa
ctcatcaatattgctgctgaacatggcatcgttttgattgccgatgaagtgtaccaaaat
aatgtctttgagagagaattcatatctgtcagaaaggtgctctacgaaatgcgtcaatct
aatcctgaattgtacgaaaatgttcaagttgcttctttacactccacttctaaaggtgtt
agtggtgagtgtggtcaaagaggaggatacatggaacttgttggatttaccaaggaagtt
aaagatgtcgttttcaagttggcttccatcaacttgtgttctgtcgtttcaggtcaggct
ttagtagaacttatggtcaatcctccaaagaaaggtgacccatcttacgaactttaccac
aaggaaacctctggaatccacaacgacttgagagaaagatcgcaaaaattgcatgctgcc
ttcaacaacatggaagacatcacttgtaacaaaccaatgggagcaatgtatcttttccca
aagttgaactttagccaagagaagtatgaaaagctttttcaaaaagctcacgaaatggag
cttacagtggatgaactttactgcacagcattgttagagaagactggaatttgctgcatt
ccaggaaatggctttggacaagtccagggcacgtatcacctcagaactacatttttggca
ccaggaaacgactggatagaaaattggtccaaatttcataaagagttcgtaaagacttac
agccagtaa

DBGET integrated database retrieval system