KEGG   Meyerozyma guilliermondii: PGUG_02206Help
Entry
PGUG_02206        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pgu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 558 aa AA seqDB search
MHAHRRCACMHAREYQDHFVSRLLTTMSQPHSRLRSRLRHSAALSRLTSATRRPSLRRRS
LSASSLTKLLLTSTTVDSDSSIPTVSATIDNTLPLDFFKLDLVGVIKALKVSKWHKRQLI
PAQLSVQRILGALTNSIYKLEYKDPVLNVNLPALLLRVYGKNVDLVVDRDTELEVLIKLL
QKKIGPRLLGIFINGRIEQFLEGYVTLNRLQIRDAVISQMIARRMKDLHYKLELDDKDRK
GIPATWKFILRWLDLFERTILPTWDNFDHREAFLTDYRKFRDAVLRYRKWLFDQYEEDIS
TNLRFCHNDTQYGNLLLHDLFSPEDIIVPQESSSLTSTTNKKDTNLAVIDFEYSGPNFPA
YDLVNHFCEWMSDYHNEECSYYIHHDRYPTQLEQLNLIKSYVEYDFHYPSSNYKTNANVD
VTSVTDILQYEIRKLYNECILWRPTVLIFWCLWGLIQNGPENDTTTDDLGSRKEEQGVGA
TYSISTGVDALQLDENVVVEDEITSSDDSFEYLKYAQQKASLMWGDLIGLGIVDELQVDQ
SMHHLIKHLDCGLFELAA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcacgcccatagacgctgtgcttgtatgcatgcgcgcgaataccaagaccattttgtc
tcacgactactaaccaccatgtcacaaccccattctcgtctgcggtctcgtctgaggcac
tcagcggctctgtcgcgactgactagtgctacaagaagaccatccttacgtcggaggtca
ctttcagcttcgtctctcacaaaacttttgcttacttcgactactgtcgattccgattcg
tcgattccaacggtttctgcaaccattgacaatactcttccccttgatttcttcaaactg
gacttggtgggagttataaaagccctcaaggtcagtaaatggcacaagagacagcttata
ccagcgcagttgtcggtgcaacgtattctgggtgctttaacgaactcgatctacaagctt
gaatacaaggatccagtactgaatgtcaacttgcctgctctcttgcttcgtgtttacgga
aaaaatgttgatctggttgttgacagggatactgagctcgaggttttgatcaaattgctg
cagaaaaaaattggtcctcgacttttgggaattttcatcaatggtagaatcgaacaattt
ttggaaggctacgttacgcttaatcgattacaaatccgagacgccgtgatttcacaaatg
atagcgagaagaatgaaggatcttcactacaaattggaattggatgataaggaccgtaaa
ggcatcccagcaacttggaaatttattttgagatggttagacctttttgaacggacaatt
ttgcccacctgggacaactttgaccatcgggaagcatttttgactgattaccgtaaattt
agagatgcagtcttgaggtacagaaaatggttatttgaccaatatgaggaggatatcagc
acaaacttgaggttttgtcacaacgatactcaatatggtaaccttcttttacatgatctg
ttctcgcctgaggatattatagtgccacaagagtcatcgtctctcacatccaccaccaat
aagaaggacaccaacttggcagtaattgattttgagtactctggaccaaattttcctgcc
tacgaccttgtgaaccatttttgtgaatggatgtctgactaccacaatgaagaatgctca
tactatattcatcacgatcgctatcccacccaattagagcagctcaatctcattaaatcg
tacgtggagtacgacttccattatccttcaagtaactacaaaaccaacgctaatgtggat
gtgacttcggtgaccgatatacttcaatacgaaatcaggaaactctacaacgagtgcatt
ttgtggcgtccaacagtgctgattttttggtgcttatggggccttatccaaaacggacct
gagaacgataccactaccgatgacttgggttcgagaaaggaagagcagggcgtaggagct
acttatagtatttctactggggtcgatgctttacaattggacgaaaatgtggttgttgaa
gatgagatcacttcaagtgacgacagtttcgagtacctcaagtatgcccagcaaaaggct
tctctcatgtggggagatcttattggtttaggcattgtggacgagctgcaagtcgatcaa
tcaatgcatcaccttatcaagcatttagactgtggattattcgagttggctgcgtaa

DBGET integrated database retrieval system