KEGG   Meyerozyma guilliermondii: PGUG_02634Help
Entry
PGUG_02634        CDS       T01150                                 

Definition
similar to vesical coat protein
Orthology
K04646  
clathrin heavy chain
Organism
pgu  Meyerozyma guilliermondii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    PGUG_02634
Exosome [BR:pgu04147]
 Exosomal proteins
  Proteins found in most exosomes
   PGUG_02634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1662 aa AA seqDB search
MSDIPIDFSELARLPALGISAQSLDFRSTTLESDKYVCVREQGPQGNTVAIIDLQNGNEV
TRKNMSADSAIMHPSQFVISLRANGTTVQIFNLGTKQRLKSFTMSQPVVFWRWLTPEVLG
LVTEDSLYTWQVFDGTNDGPVKLTDRHHSLNNAQIISFVAEPALNWYAVTGIAQENGRIA
GHIQLFSKSRNVSQAIEGHVSKFAEIKLNGAPHPTKVFCVGNKNANGEGNLHIIEIDHPE
GNPPFQKKLVDIYFPADAASDFPISLQALNKYGIIYILTKYGFIHLYDIETGTNLFVNRI
SSDPVFTASAYNEGTGIIAINKAGQVLSVEVAREKIVPYVLEKLSNVSLALALSLRGGFP
GAENLFQQQFQNFLNQGDYTNAAKVAALSDQLRTQDTINKLKHITPQPGQISPILQYFST
LLDRGTLNKYESIELAKPVLQQDRKPLFEKWLKEEKLTCSEELGDIVKSYADAALALAVY
IRANNHIKVVSSLAELGQFDKILPYCERVNYHPDFTHLIQNLVRVNPDKASEFATLLLAS
PETKLDVENIADLFFSQNYIQQGTAFLLDALKNDSPSEGHLQTKVLETNLIHAPQVADAI
LGNQMFSHYDKPTIGKLCEKLGLFQRALEHYDDLKDIKRVIVHTNVLPNDWLVQYFGQLN
VQQSVACIKELLSNNMKQNLQVVIQVATKYSDLIGPLTLIKIFEEFKCNEGLYYYLSSIV
NITQDPDVVLKYIQTAAKMNQAKEIERVVRDNNIYNGEKVKNFLKEAKLEDQLPLIIVCD
RFNFVHDLILYLYKNHFFKFIEVYVQQVNPTNTPQVVAGLLDVDCDENIIKGLLASVIGR
VPIKELVAEVEKRNRLKILLPFLEKTLEGGSTDQEVFNTLAKIYIDSNNSPEKFLQENDN
YDTLAVGKYCEKRDPYLAYICYSKGSNDDELIAITNDNKMYKYQARYLLSKSDFALWSKV
LTSDNTHRRQLVDQVISTGIPELNDPEPISITVKAFMENDMQEELIELLEKIILEPSPFN
DNTSLQGLLILTAIKADPSRVLNYIEKLDKFDPQEIAPLCVDNQLYEEAFEVYDKFEMRN
EAMKVLVEDIMSLDRGEQYAEKYDTSDLWYQLGTAQLNGLRVPEAIDSYVKSKNPENYEH
VIEIAEHAGKEEELIAFLEMARETLRESVIDGAMINCLANLNKLDEIDKFVAGPNVADLE
AIGDKLFAAKNYKGAKILYSNVSKYSKLATTLVYLEDYQGAVDCARKASNIDVWKKVNAA
CIENKEFRLAQICGLNLIIDAEELPELVRTYEHNGYFNELIALFESGLGLERAHMGMFTE
LAILYSKYSPEKVMEHLKLFWSRINIPKVLTACEEAHLYPELIFLYCHYEEWDNAALTMI
KRSEVAFDHSSFKEIIVKVPNLEIYYKAINFYMNENPSLLVDLLAVLTPKLDLPRVVRMF
VKSDNLPMIKPFLISVLEKNNSVVNGAYHDLLIEEEDYKSLKAAVENESCNRFNSLDLAE
RLENHKIIFFRQISATLYAKNKKYAKAISILKSDKLWADLLKTAAISKSTKIAHELLDYF
VETGNHECFVALLYVCYDLIEFDYVLELSWLHDLSNFVKPYEISIAYENRKRMDELYADL
QKRKAAEQEDEETPTGQPLMITNGPVGGLGYQPTGAGFGNAF
NT seq 4989 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatatccccattgacttttccgagttggctcgtttgccagcgttgggcatctcg
gctcaatcgttggatttccggtccacaactttggaatctgataaatatgtctgtgttcga
gaacagggccctcaaggcaacaccgtggccatcatagatctccaaaatggtaacgaagta
accaggaagaacatgagtgcagacagcgccatcatgcatccgtctcagtttgttatctcg
ctccgggccaatggaaccacggttcaaatattcaacttgggaacgaaacaacgactcaag
tcattcaccatgtctcagccggttgtgttttggcggtggttgacacccgaggtgcttggt
ctcgttactgaggactccttgtatacgtggcaggtttttgatggcaccaatgatggtcct
gttaagttgactgatcgtcaccattcgcttaacaatgcgcagatcatcagttttgtcgcc
gaaccagcgctcaattggtatgctgtaactggtattgcccaggaaaacggtcggattgct
ggtcatatccagcttttctccaaatctcgtaacgtttctcaagcaattgagggccatgtg
tccaagtttgctgaaatcaaattgaacggcgctcctcaccctaccaaggtgttctgtgtg
ggtaacaagaacgctaatggcgagggtaacttgcacatcatcgagatcgaccaccctgaa
ggaaatccacctttccagaaaaaactggtggacatttacttcccagccgatgccgccagc
gacttccccatctcgttgcaggcgctgaacaagtatggaatcatctatatcctcaccaag
tatggttttattcacttgtacgatatcgaaacaggtaccaatctctttgtcaaccggatt
tcttccgatcctgtgttcactgcctcggcctataatgagggcacaggtataattgccatc
aacaaggcaggtcaggtgttgtccgtcgaggtggcacgcgaaaaaatcgtgccttatgtg
cttgaaaagttgtcaaacgtcagtttggctctcgctctttccctgcgtggaggtttccct
ggtgctgaaaacttgttccagcaacaattccaaaactttttaaaccaaggcgattacacc
aatgctgctaaagttgcagctctgagtgatcaattgcgtactcaggacactatcaataag
ttgaaacacattactcctcaaccgggtcaaatctctccaatcttacagtacttctccaca
ttgttggaccgcggtaccttgaacaagtacgaaagtattgaattggcaaagcctgttctt
caacaagaccgcaaaccattgtttgagaaatggttgaaggaagaaaagttgacctgttct
gaagaattgggtgacattgtcaagtcatacgcagatgctgcattggctttggctgtgtat
atccgcgccaacaaccacatcaaggttgtatcatcgttagctgagttgggccagtttgac
aagattttgccatattgtgaacgagtcaattatcatcctgatttcactcaccttattcaa
aacttggttcgagtcaaccctgacaaagcctccgaatttgccaccctgcttttagcaagc
cctgagaccaaattggacgttgaaaatattgctgatcttttcttctcccaaaactatatc
caacaaggtactgctttcttgttagatgccttgaaaaatgattcaccctcagaaggtcat
ttgcaaacgaaggttttggagaccaatttaatccatgccccacaggttgccgatgccatc
ttgggaaatcaaatgttttctcattacgataaacccacaattggcaagctttgtgaaaaa
ctgggcttgtttcaaagagctttggagcattatgacgacctcaaggacatcaagcgagtt
attgtgcacaccaacgtcttgcctaacgactggttggttcaatacttcggtcagttgaac
gtccaacaatccgtcgcttgtatcaaggagcttttgagcaataacatgaaacagaatttg
caagtggttattcaggtggccaccaagtattctgatttgattggtccattgactcttatc
aaaatctttgaagagttcaagtgtaacgaaggattgtattattacttatcttccatcgtc
aacatcactcaggatcctgatgtagtcctcaaatacattcagactgctgccaagatgaac
caagcaaaggaaattgagagagttgtgcgtgacaataatatttacaatggggagaaggtt
aagaactttttgaaagaggctaaattggaagaccaattacctttgatcattgtatgtgac
agattcaactttgttcatgacttgattttgtatttgtacaaaaatcactttttcaagttt
atcgaggtctacgtgcaacaggtgaaccctactaacactcctcaagtggtcgctgggtta
ttggacgttgactgtgacgaaaacatcatcaaggggcttctcgcatcagttatcggacga
gtaccaatcaaggaacttgtggcagaagttgagaagagaaacagactcaagatcttgctt
cctttcttggagaaaactttggaaggtggatccactgatcaagaggtttttaatactttg
gcaaagatttacatcgattccaataacagccctgaaaaattcttacaggagaatgacaac
tacgatactttggcagttggtaagtactgtgaaaagcgagacccctacctcgcctacatt
tgttactctaagggttccaatgatgatgaattgattgcaatcaccaatgacaataagatg
tacaagtatcaggcaaggtacttgttgtctaaatctgacttcgcattatggagcaaggtt
ttgacaagtgacaacactcacagaagacaattagtcgatcaagttatttccactggaatt
cctgaattgaatgatccggaacctatttcaattaccgtgaaggcttttatggagaatgac
atgcaagaggaattgatcgaattgttggaaaaaatcatcttagagccatctccattcaat
gacaacacgtcgttgcaaggtttgttaatccttacagccattaaagctgatccatctcgt
gtgctgaactatattgagaagcttgataagtttgacccacaagagattgctcccttgtgt
gttgacaaccagttgtacgaggaggcttttgaagtatatgataagtttgaaatgagaaat
gaagctatgaaggttttggtcgaggacatcatgtcgttggatcgtggagagcaatacgct
gagaaatacgacacttcggatttgtggtaccaattgggtactgctcaattgaacggtttg
cgggttcccgaagctattgactcttacgtcaagtcgaaaaatcctgaaaactatgagcat
gttattgaaatcgctgaacatgcaggtaaggaggaggaattgatagcattcttggaaatg
gccagagagacattgagagaaagtgtcatcgatggagccatgatcaactgtcttgctaac
ttgaacaagttggacgagatagacaagtttgttgctggtccaaatgtggcagacttggaa
gcaattggtgataaattatttgctgctaagaactacaagggcgccaagatcttgtactcc
aacgtttccaaatactcgaagcttgccacgactttggtctacttggaagactatcaagga
gctgttgattgtgccagaaaggcttccaatatcgacgtatggaagaaggtgaatgctgct
tgtatcgagaacaaggaattcagattggcacaaatttgtggtttgaacttgattatcgat
gctgaagaacttcctgagttggtcagaacctatgaacacaacggatatttcaatgaattg
atcgcattattcgagagtggtttaggtttggagcgtgcccacatgggtatgttcacagaa
ttggctattttgtacagtaagtacagcccagagaaggtgatggagcacttgaagttgttc
tggtccagaattaacattcctaaagtgttgacagcctgtgaggaagcacacttgtatccc
gagttgatcttcttatactgtcattacgaggaatgggacaatgctgcattgaccatgatc
aagagatctgaagttgcttttgatcactcatccttcaaggagattattgtcaaggttcca
aacttggaaatctactacaaggcaatcaacttttacatgaatgaaaacccatcactttta
gtggacttgttggcagtcttgacccccaagttagacttgcctagagttgttcgcatgttc
gtcaagtctgacaacttgccaatgatcaaaccgttcttgatttccgtcttggagaagaac
aactcggtagtaaacggtgcttaccacgacttgttgatcgaagaggaagactacaagtcg
ttgaaagctgctgttgaaaatgagtcgtgcaacagattcaactctttggatttggcagag
agattggagaaccacaagatcatctttttcagacaaatctccgccactctttatgccaag
aacaagaagtatgccaaagctatttccatcttgaagagtgacaagttatgggcggatctt
ctcaaaactgctgccatatcaaaatccaccaagattgcccacgaattgttggattacttt
gtggagacaggaaaccacgaatgtttcgttgcattgttgtacgtttgttatgatttgatt
gagttcgactatgttctcgagttgtcgtggctccacgacttgagtaatttcgtcaagcca
tacgagatctcgattgcatatgagaaccgcaagcgtatggacgaattgtatgctgatttg
cagaagagaaaggctgctgagcaggaggatgaggaaactcccactggacaacctttgatg
attacaaacggacccgttggaggtcttggttatcaaccaaccggagctggttttggtaac
gccttttaa

DBGET integrated database retrieval system