KEGG   Meyerozyma guilliermondii: PGUG_02654Help
Entry
PGUG_02654        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGUG_02654
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGUG_02654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1438 aa AA seqDB search
MDLDTSLADFHSTETLVSTPKYSYGVLINVILLVLWTCFRVVNWFLVTLPSILLGMLSKT
FQITLSLSSILMFVVAVTAICFLVVRYKYLTRYSRNSAAKEPAKKLFDIDDLSKKKKLLS
KTSSNYLDQFLSAIQVFGYLEGPVFHELTRNMTTQKVLPNEVLYLDESLGFLIVVEGTMQ
VYTKVTNLSNLSLNAEDDGLDLRYENDDVLCIGNDKYQLLNEVKSGAPLSSLMSTLDLFT
SNEVPLLPTKFGSYSLTAVTPLELSPNNTGGNSPPPSLAPEIVARPKGTTSTTLAIIPYT
AFQRLHKKYPKATSHIVTMVLTRLYKVSMNTIYNYLGLSKDILDCERNLNAETNERLPSY
LSKGIIEKFHKTEELASVEGLPTLPRRSTVNLRALTRQASSSRYVVLASRSKSTHPGDLL
SSVPLSRRSDYYETQTIPNESEDLPTIQRSSLRRRASHSTSLRKSNSVLEDIRVRGFSNE
REETEETSLRTAIVEQIFTHLGISEDDPTVMNINPTSASSSASSSIVGISKLNYGSLDSI
NSPRVDPMTSIRSSLASNGNKVYQTINQHTKEADVLQEKPKKVVLPGSRGDDSDFVAVKD
EFARAIQMKYIQPGKTIIEQDSFHTGIFYVIDGSLDVIQESNGKSKKIYTVKAGGITGYL
NCLIGMKSLVLVKASEDSSAIVAHIPSHMYSKLIDKFYFLQLPIARRLKRLLSKQFLTID
YALEWCHISAGDILSKEGEPANGFHIVLSGRFRVVKFKTPFKPVASKAGHDTYDYNDNLI
DESNKKYTSNDVEILGEYGHGESIGEVEVLTASLRKNTLIAVRDSETARIPRALFELLSL
QNPSIMVKVSRIVANRLSKKDSEEILDKPLAMTLSDSPYISSNFKTITILPTVSQLPVRE
FADKLVQALKAIGRNVIALDQASTLTHLGKHAFDERLAELKLSGYFAYLEEKYETIVYVC
DTPVKSNWTSTCISQGDCILLLADADDEDTAESIGSYERLLIKLKTTARTDLCLIHPEKY
VTPGSTSIWLKNRVWVQGHHHIQMEISPTQTTLVMKPKIPIISELAKKIKDRANPNIKLK
LEEVKGKALASFVKLNNKINAHGRMSFNGVSVHKNDFLRLARILSNEAVGLVLGGGGSRG
ISHVGVVIALEKHGIPIDLVGGTSIGSFVGGLYAMDYNTVSIYGRAKKFAKRVSSFWRIL
TDLTYPVTSYMTGYEFNRGIWKIFGFTEIEDFWLRYFCNSTNITNSTMDIHETGYLWRFI
RASMSLAGLLPPITYNGSMLLDGGYLDNLPVLEMKKKGAKYIIAVDVGSVDDRTPMNYGD
TLSGFWVLLNRWNPFSKHPDVPNMMDIQLRLAYVASVNALEISKKTPGVMYLRPPIENYA
TLDFAKYDEIYRVGYVYADELFTLWKSSGKLPDIAGMGDKVRKDMSGEHVSLSRRNSI
NT seq 4317 nt NT seq  +upstreamnt  +downstreamnt
atggatctggacacatcactggcggactttcatagcacggaaactttggtttctacccca
aaatattcttatggtgttcttataaatgtcatcttgttggttctgtggacatgctttcgc
gtggtgaattggttcttggtgacgctaccgtcgattttgcttggaatgctctccaaaact
ttccaaatcaccttgtcactttcgtcgattctcatgtttgtggttgcagtgacggctatt
tgtttcttggtggttcggtacaaatacttgacaagatactctcgaaactcagctgccaaa
gaaccagcgaaaaagctgtttgatatcgatgatctttcgaaaaagaagaaactgctgtcc
aagacttcttccaattacttggaccagttcttaagtgcaattcaggtttttggatacttg
gagggcccggttttccacgagttaacgagaaatatgactacccagaaagtccttccgaac
gaggttttgtacttggatgagtcgttggggttcctgattgtggtcgagggaactatgcaa
gtatacaccaaagtcaccaacctctcgaatctgagtttgaacgctgaagacgatgggtta
gatttgcggtacgaaaatgacgacgttctttgcattggaaacgacaagtaccagctttta
aatgaggttaagagtggagcaccgttgtcttcacttatgagcactttggaccttttcacc
tccaacgaagtaccacttctgccaactaaatttggctcttatagtctcaccgctgtcacc
cctcttgaattgagtcccaataatactggtggcaactctccacctccttcacttgctcca
gaaattgttgcgaggccaaagggcaccacaagcacaactttggcaattatcccatataca
gcattccaaagactccacaaaaagtatcccaaggcaacttcacacatagtcaccatggta
ttaaccagactctacaaggtttcgatgaacactatttataactacttggggctttctaag
gacattttagattgcgaacgaaatctcaatgctgaaactaacgaaaggcttcccagttat
ctttccaaaggaatcatcgagaaatttcacaaaaccgaagaactggcttctgttgaaggc
ctgccaacgctcccccggagatctaccgtcaacttgagagcacttactcgtcaagcatct
tcatctcgctatgtcgttcttgcatctcgctccaaatctacccatccaggtgatctcttg
tcttccgttcccttgtcgagaagatcagactactacgaaacccaaaccattccaaatgaa
tcggaggatctgcccaccatccaaaggtcctctctcagacggcgagcatctcattccact
agtcttcgaaagagtaacagtgttcttgaagatatccgtgttcgtggcttttccaatgaa
cgtgaagagaccgaagagacatctttgcgtaccgcaattgtggagcaaatcttcacgcat
ttgggtatatctgaagacgatcccactgtgatgaatatcaatccgacttcggcgtcttct
tcagcatcgtcttcaattgtgggcatttcaaagttgaactatgggtctttagattccatt
aatagtcctcgtgtggaccccatgaccagtattcggtccagtttagcaagtaatgggaac
aaagtgtaccaaacaatcaaccaacacacaaaggaagcagacgttttacaagaaaaacca
aagaaggtggttttgcccggctctagaggtgacgattctgactttgtggcagtgaaagat
gaattcgctcgagctatacaaatgaaatatatccagccaggtaaaactatcattgaacag
gactcgttccacacaggtatattttacgtcattgatggttctctagatgtgatacaagag
tcaaacggcaagtcgaaaaagatctataccgtgaaagctgggggcatcactggctactta
aactgccttattggcatgaaatctttggtgctggtgaaagcatctgaagattcgagtgcc
attgttgcacacatacccagtcacatgtactccaagttgattgacaagttttactttctt
caactacccattgctagacgcttgaagcgattgttatcaaagcaattcctcaccatagac
tatgccttggaatggtgccatatttctgctggggacatcttgagcaaagagggtgagcca
gcaaatggattccacatagtattgagtggacgatttcgagtggtcaagttcaaaacacct
tttaaaccggttgcctcaaaggcaggtcatgatacttatgactacaacgacaacttgatc
gacgagagcaataaaaagtatacttcgaatgatgttgaaattttgggagaatacggccat
ggtgagtctattggagaagttgaagtattaacagcatctctcagaaaaaacactttgatt
gcagttcgtgactcagaaacagccaggatacctagagcgctttttgaattactttcgctc
caaaacccatcaataatggtgaaagtttcaagaattgtcgccaatagactctcaaaaaaa
gactcggaggagatcctagataaaccacttgcaatgacactgtctgacagtccatatatc
tcgagcaacttcaagacgatcaccatattacccaccgtttcccagcttcccgttagagaa
tttgcagacaagttagtacaggcattgaaagcgataggcagaaacgttatagcacttgat
caagcttctacacttactcatcttggaaagcatgcatttgacgaacgacttgccgagctt
aaactttccggctactttgcctacttggaggagaagtatgaaacgattgtctacgtttgt
gatactccagtcaagtccaattggacttctacttgtatctctcagggtgactgtattctt
ttgcttgctgatgctgacgatgaagatactgctgaaagtattggatcttacgagagacta
cttattaagctaaaaaccacagcaagaaccgatctctgtttgatacatcccgagaagtat
gtgactccaggatctacgagtatttggttgaagaacagagtatgggttcaaggtcatcat
catatacagatggaaataagcccaacgcaaactacgctggtgatgaaaccaaagatccca
ataatcagtgagttggccaagaagatcaaggatagagctaatccaaacataaagttgaaa
ttagaggaggtcaagggaaaagcattagcatcgtttgtcaagttgaacaataagatcaat
gcacatggacggatgtctttcaatggagtgtcggtgcacaagaacgattttcttcgactt
gctcgtattctctcgaatgaggccgttgggcttgttttgggtggaggagggtctcgtgga
atctctcacgttggcgttgtaattgcacttgaaaaacatggtattcccatagatcttgtt
ggcggaacctcaatagggtcgtttgtgggtggactctatgctatggactataacacagtt
tcgatttatggccgagccaaaaagtttgcaaagagagtgtcttcgttttggagaatcctc
acagacttaacataccccgtcacttcctatatgaccggttatgagttcaatagaggtatc
tggaagatttttggctttacagaaattgaagatttttggctccgctacttttgcaactcc
accaatattaccaactccaccatggatatacacgaaactgggtacctgtggcggtttatt
agagcttcaatgtcgttggctggcctactccctccgattacatacaacggttctatgctt
ctcgatggaggctacttggacaatttacctgttctggaaatgaagaaaaaaggtgccaag
tacatcattgctgttgacgttgggtcagttgacgacagaacacccatgaattacggtgat
acactttccggattttgggttcttctcaaccgttggaacccattttctaagcatcctgat
gttccaaatatgatggatattcaattgagattggcatatgtcgcaagtgtcaatgctctt
gaaatctcgaaaaagacaccaggcgtgatgtatctccggcccccaattgagaactatgct
actttggactttgccaagtacgatgaaatctatcgcgtggggtatgtgtacgcagatgaa
cttttcactctgtggaaaagcagtggtaagctacccgatatcgcgggaatgggagacaag
gttcggaaagacatgtctggagagcatgtttcgttgagcagacgtaattctatttaa

DBGET integrated database retrieval system