KEGG   Meyerozyma guilliermondii: PGUG_02657Help
Entry
PGUG_02657        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 342 aa AA seqDB search
MSIVAATRQSSSRMGYALAGLAGAGASIYAYQEYRRRTPGPSPLMAASGVVNNAYVPKGV
GFEDYQKVYNDIAAKVHEQEDADGGIGRYGLLCRLGWHTSGTYDKNDNTGGSYAGTMIYS
PESIDGANAGMEVARDFLYEFKDKYPFLSRGDLWTLGGVVAVQESGGPKIPWRPGRKDIP
ERSRVPEAGRLPDASKDGEYVKNLFARLGMDERETVALIGAHVLGQCHSYYSGYSGPWGP
SYNMFTNDFFVRLLGKWHVKKWDGPKQYEDDETNSFMMLPTDIALKEESYFVKYVKMYAE
DQDLFFKDFSKAYSKLMELGVTFPKDQKQWEFKTLDEQDDEE
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgttgcagccaccagacaatcttcctcacgtatgggctacgctcttgctggg
cttgctggtgctggagcttcaatttatgcctaccaagaataccgcagaagaacccctgga
ccaagtcctttaatggcagcttcaggagtggtgaacaatgcttatgttcccaagggagtt
ggctttgaagactaccaaaaagtttacaatgatattgctgccaaggttcacgagcaagaa
gatgccgatggaggcattggtcgttatggtttgctctgtagacttggctggcacaccagt
ggtacctacgacaagaatgacaatacaggagggtcgtatgctggtactatgatctacagt
cctgagtcaattgacggcgccaatgccggtatggaggttgcaagggactttttgtacgag
ttcaaagacaagtacccatttctctctcgtggagatttgtggactttgggaggtgtggtt
gctgtccaggagtctgggggacccaagattccttggagaccaggacgtaaggatattcct
gagagaagccgggtgccagaagctggaagattgccagatgcttcaaaagatggtgaatac
gtcaagaacttgtttgcgagattgggcatggacgagcgggagacagtggccttgattggt
gcccatgttttgggtcaatgccattcttactattctggttactctggtccatggggtcct
tcgtacaacatgttcaccaacgactttttcgtgcgcttgttaggcaagtggcacgtcaaa
aagtgggatggccccaagcagtatgaagatgacgagaccaactcgttcatgatgttgcca
actgacattgctttgaaagaagaatcttatttcgtcaagtatgtcaagatgtacgctgaa
gaccaggacttgtttttcaaggacttttctaaggcatattccaagttgatggagctcgga
gtaacgttcccaaaggaccagaaacaatgggagttcaagacattggacgaacaagacgac
gaggaatag

DBGET integrated database retrieval system