KEGG   Meyerozyma guilliermondii: PGUG_02674Help
Entry
PGUG_02674        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PGUG_02674
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PGUG_02674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 186 aa AA seqDB search
MSLRPIVISGPSGTGKSTLLKRLLAEYPDKFGFSVSHTTRSPRDGEKNGTDYHFVTKEEF
QKEIEGKKFVEWAQFSGNYYGTSIKAVEDVASTGKTCILDIDMQGVKSVKASRLNARYLF
LSPPLIEELRSRLEGRGTETAESVEKRLAAATAEMEYAQTGAHDKIIVNDDLEKAYGEFK
AFVLEQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgcgccctattgttatttccggcccttctggaactggcaagtccaccttgttg
aaaaggcttttggctgagtatcctgacaaatttggattttcggtttcccatacaaccagg
tctcccagagatggagaaaaaaatggcactgattatcattttgtcaccaaggaagagttt
caaaaggaaatagaaggcaaaaaatttgttgagtgggctcagttttctggaaactactat
ggtacctcaattaaggcagtggaggatgtagcttctactggtaagacatgtattcttgac
attgatatgcaaggagttaaatctgtcaaggcgtcgcgtcttaacgccaggtaccttttc
ttgagtcctccgctgatcgaggagttgcgttctcggttggaaggccgtgggactgagacg
gctgagtctgtggaaaagcgtcttgcggctgccaccgccgagatggaatacgcccaaacc
ggagcccacgacaagataatagtgaacgacgacttggagaaggcgtatggcgagttcaag
gcgtttgttttggaacaatag

DBGET integrated database retrieval system