KEGG   Meyerozyma guilliermondii: PGUG_02674Help
Entry
PGUG_02674        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00230  Purine metabolism
pgu01100  Metabolic pathways
Module
pgu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PGUG_02674
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PGUG_02674
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 AAA_28 ABC_tran RNA_helicase DUF2075 MMR_HSR1 ATPase_2 RsgA_GTPase AAA_30 NTPase_1 AAA_14 T2SSE AAA_24 AAA AAA_29 NACHT Rad17 AAA_5 cobW Adeno_IVa2 AAA_2 AAA_19 MobB Cytidylate_kin Roc NAGLU_N dNK AAA_23
Motif
Other DBs
NCBI-GeneID: 5126647
NCBI-ProteinID: XP_001484945
UniProt: A5DHC3
AA seq 186 aa AA seqDB search
MSLRPIVISGPSGTGKSTLLKRLLAEYPDKFGFSVSHTTRSPRDGEKNGTDYHFVTKEEF
QKEIEGKKFVEWAQFSGNYYGTSIKAVEDVASTGKTCILDIDMQGVKSVKASRLNARYLF
LSPPLIEELRSRLEGRGTETAESVEKRLAAATAEMEYAQTGAHDKIIVNDDLEKAYGEFK
AFVLEQ
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgcgccctattgttatttccggcccttctggaactggcaagtccaccttgttg
aaaaggcttttggctgagtatcctgacaaatttggattttcggtttcccatacaaccagg
tctcccagagatggagaaaaaaatggcactgattatcattttgtcaccaaggaagagttt
caaaaggaaatagaaggcaaaaaatttgttgagtgggctcagttttctggaaactactat
ggtacctcaattaaggcagtggaggatgtagcttctactggtaagacatgtattcttgac
attgatatgcaaggagttaaatctgtcaaggcgtcgcgtcttaacgccaggtaccttttc
ttgagtcctccgctgatcgaggagttgcgttctcggttggaaggccgtgggactgagacg
gctgagtctgtggaaaagcgtcttgcggctgccaccgccgagatggaatacgcccaaacc
ggagcccacgacaagataatagtgaacgacgacttggagaaggcgtatggcgagttcaag
gcgtttgttttggaacaatag

DBGET integrated database retrieval system