KEGG   Meyerozyma guilliermondii: PGUG_02695Help
Entry
PGUG_02695        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pgu00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 639 aa AA seqDB search
MLRTLFFFIWAAFVVARSPTGGYAPGTVACPKGVKSFIREGNTISNEEKDWIKERHKITD
QALAEFLKSVNMTDFDVDEFMTKNSSLLVNIAVSVSGGGYRSMLTGAGQVAALDNRTQDA
LEVGLGGILQSSTYFAGLSGGAWLVGSLTMQDFASVDQIVFEDPDDLWNLTETRQLPNTT
SLWKVIYPAIRLDAIGVLSHINNWNNGIQLDLEKKEAAGYETTITDAWGRALAFQLFPKG
KDNHGAATTWSDIRDLNAFKNHEMPFPILVSLARQPDSIFYSLNSTVVEANPFEMGSFDT
DLNTFVDIKYLGTNLVDGKSNGSCVAGYDNAGFMIGTSSSLFNQFLYTLVCEECKLVGKP
FDYVLKPILKRFLLKISSDKDDVAVVKPNPFYHSRYGTDNNITTDESLVLFDGGLGGETI
PLSNLMTKERKLDAVFAFDNANWPNGSSLVDAYLRQFVDKGESSLCPYVPDAISFMQQNL
TAKPTFFGCDAKNLTDLAKDGVVPPLVIYLANRPYEFLSNTSTFQNSYTDQEKKAMIQNG
FDITSRLNGTIDEEYRACIGCAVIRREQERLGQQQTDQCKKCFKRYCWDGTISRMNTTNY
SPPVNFTNSGLTNRSMDVPTLKINESPKSSFSIFSLFKI
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacattattcttcttcatctgggcagcgtttgttgtcgcaagatctccaacc
ggtgggtatgcaccaggcacagtagcttgtcccaaaggtgtcaaatctttcatccgagaa
ggtaacactatttctaatgaagaaaaagactggattaaggagcgacataagataaccgac
caggcattggccgagtttttgaagtcggtgaacatgacagacttcgacgttgatgagttt
atgacaaaaaattcttcgctgctggtgaacatcgcagtgtcggtatctggaggtggttac
cgatccatgttaaccggagcaggacaagttgctgctcttgataatagaacacaggatgct
ctggaagtaggtttgggtggaatacttcagagttcgacctattttgccggactttcaggt
ggagcatggttggtgggttcgttgacgatgcaagattttgccagtgttgaccaaattgta
tttgaagatccagatgatttgtggaatcttaccgagactcgccaattgcccaacaccacg
tccctctggaaagttatatatcctgctattcgcttggatgccattggagtattgtcacac
attaacaattggaacaacggcattcagctggaccttgagaaaaaagaagcagctgggtac
gaaaccactatcactgatgcttggggtagagcattagctttccagctttttcccaaaggc
aaagacaaccatggagcagccactacctggtctgatattcgcgatctcaatgccttcaag
aaccatgaaatgccgttccccattctagtttcattagcacgccagccagattcgatcttt
tacagtttgaattcgacggtcgtggaagctaatccgttcgaaatgggctcctttgatacg
gatctcaacacgtttgtggatatcaagtaccttggcaccaaccttgttgatggtaagagt
aacggaagttgtgttgctggttatgacaacgctggctttatgattggaacctcttcttct
cttttcaaccagttcctttatactcttgtttgcgaggaatgtaagctagttggaaagcca
tttgattatgtcttgaaacccattttgaagagatttctcttgaagatatcttctgacaaa
gacgatgttgccgttgtgaaacccaatcctttttaccactccagatacggtacggataac
aatattaccacagacgagtcactcgtactcttcgacggtggacttggaggagagacaatt
cctctttctaaccttatgacaaaggaacggaaactcgatgcggtttttgctttcgacaat
gctaactggcccaatggatcctccttggttgatgcgtacctgagacaattcgtagacaag
ggcgagtcgtctctttgtccatacgtacccgatgccatatctttcatgcaacaaaatttg
actgcaaagccaacttttttcggttgtgatgccaagaaccttactgacttggcaaaggac
ggtgttgttccaccattagtcatctacctcgcaaaccgtccctacgagtttttgtcaaat
acctcaacttttcaaaactcttatactgaccaagaaaagaaagcaatgattcaaaacgga
ttcgacatcacttctcgtctcaacggaaccattgacgaggagtacagagcgtgtattggc
tgtgccgtgatcagaagagaacaagaacgtttgggacaacagcagaccgaccaatgcaaa
aagtgcttcaaacgctactgttgggatggtaccattagtcgaatgaataccaccaattac
tctcctccagtcaatttcactaatagtgggctcacgaacagatccatggatgtacccaca
cttaaaatcaacgagtcaccaaaaagctcgttttcaatatttagtcttttcaagatttaa

DBGET integrated database retrieval system