KEGG   Meyerozyma guilliermondii: PGUG_02695Help
Entry
PGUG_02695        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PGUG_02695
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PGUG_02695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 639 aa AA seqDB search
MLRTLFFFIWAAFVVARSPTGGYAPGTVACPKGVKSFIREGNTISNEEKDWIKERHKITD
QALAEFLKSVNMTDFDVDEFMTKNSSLLVNIAVSVSGGGYRSMLTGAGQVAALDNRTQDA
LEVGLGGILQSSTYFAGLSGGAWLVGSLTMQDFASVDQIVFEDPDDLWNLTETRQLPNTT
SLWKVIYPAIRLDAIGVLSHINNWNNGIQLDLEKKEAAGYETTITDAWGRALAFQLFPKG
KDNHGAATTWSDIRDLNAFKNHEMPFPILVSLARQPDSIFYSLNSTVVEANPFEMGSFDT
DLNTFVDIKYLGTNLVDGKSNGSCVAGYDNAGFMIGTSSSLFNQFLYTLVCEECKLVGKP
FDYVLKPILKRFLLKISSDKDDVAVVKPNPFYHSRYGTDNNITTDESLVLFDGGLGGETI
PLSNLMTKERKLDAVFAFDNANWPNGSSLVDAYLRQFVDKGESSLCPYVPDAISFMQQNL
TAKPTFFGCDAKNLTDLAKDGVVPPLVIYLANRPYEFLSNTSTFQNSYTDQEKKAMIQNG
FDITSRLNGTIDEEYRACIGCAVIRREQERLGQQQTDQCKKCFKRYCWDGTISRMNTTNY
SPPVNFTNSGLTNRSMDVPTLKINESPKSSFSIFSLFKI
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaacattattcttcttcatctgggcagcgtttgttgtcgcaagatctccaacc
ggtgggtatgcaccaggcacagtagcttgtcccaaaggtgtcaaatctttcatccgagaa
ggtaacactatttctaatgaagaaaaagactggattaaggagcgacataagataaccgac
caggcattggccgagtttttgaagtcggtgaacatgacagacttcgacgttgatgagttt
atgacaaaaaattcttcgctgctggtgaacatcgcagtgtcggtatctggaggtggttac
cgatccatgttaaccggagcaggacaagttgctgctcttgataatagaacacaggatgct
ctggaagtaggtttgggtggaatacttcagagttcgacctattttgccggactttcaggt
ggagcatggttggtgggttcgttgacgatgcaagattttgccagtgttgaccaaattgta
tttgaagatccagatgatttgtggaatcttaccgagactcgccaattgcccaacaccacg
tccctctggaaagttatatatcctgctattcgcttggatgccattggagtattgtcacac
attaacaattggaacaacggcattcagctggaccttgagaaaaaagaagcagctgggtac
gaaaccactatcactgatgcttggggtagagcattagctttccagctttttcccaaaggc
aaagacaaccatggagcagccactacctggtctgatattcgcgatctcaatgccttcaag
aaccatgaaatgccgttccccattctagtttcattagcacgccagccagattcgatcttt
tacagtttgaattcgacggtcgtggaagctaatccgttcgaaatgggctcctttgatacg
gatctcaacacgtttgtggatatcaagtaccttggcaccaaccttgttgatggtaagagt
aacggaagttgtgttgctggttatgacaacgctggctttatgattggaacctcttcttct
cttttcaaccagttcctttatactcttgtttgcgaggaatgtaagctagttggaaagcca
tttgattatgtcttgaaacccattttgaagagatttctcttgaagatatcttctgacaaa
gacgatgttgccgttgtgaaacccaatcctttttaccactccagatacggtacggataac
aatattaccacagacgagtcactcgtactcttcgacggtggacttggaggagagacaatt
cctctttctaaccttatgacaaaggaacggaaactcgatgcggtttttgctttcgacaat
gctaactggcccaatggatcctccttggttgatgcgtacctgagacaattcgtagacaag
ggcgagtcgtctctttgtccatacgtacccgatgccatatctttcatgcaacaaaatttg
actgcaaagccaacttttttcggttgtgatgccaagaaccttactgacttggcaaaggac
ggtgttgttccaccattagtcatctacctcgcaaaccgtccctacgagtttttgtcaaat
acctcaacttttcaaaactcttatactgaccaagaaaagaaagcaatgattcaaaacgga
ttcgacatcacttctcgtctcaacggaaccattgacgaggagtacagagcgtgtattggc
tgtgccgtgatcagaagagaacaagaacgtttgggacaacagcagaccgaccaatgcaaa
aagtgcttcaaacgctactgttgggatggtaccattagtcgaatgaataccaccaattac
tctcctccagtcaatttcactaatagtgggctcacgaacagatccatggatgtacccaca
cttaaaatcaacgagtcaccaaaaagctcgttttcaatatttagtcttttcaagatttaa

DBGET integrated database retrieval system