KEGG   Meyerozyma guilliermondii: PGUG_02714Help
Entry
PGUG_02714        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11401  
histone acetyltransferase SAS2 [EC:2.3.1.48]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MEDGGQVPLVENGSKVPKSRLRALKNDFYGIVDFRNIDKVTLGNYEFHTWYGNTAYFSRA
NNSHPELGINTLVPRKKHLGGDPTSDFWLKTLHVCEYCFKYCAEKSSMSSHRLVCTKNTP
FPQTGRLVYRDPISKYVIKQVRGYRHQLFCQNLCLFAKLFLDDKSVYYNVDAYEFFIIYG
HPDTGSEIDRNMVPMGYFSHELGAWDNDNNLACICVFPPFQNRRLGTLLIDLLYEVPRAH
GQSEPTGPEYPLLPFGRATYLRYWAKRLAHILLCSLQRKTLFTLQDLSDLTGFRKEDILL
TLEFMQVLGKKVVLQNGEEEGCKPVLLLENLRQWCVRNRVETSQDMRMLNPDYLVL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggaggatggtggtcaggttccattggttgaaaatgggtctaaagtgcccaaatcacgt
cttagggcactgaaaaatgacttctatggcatagtggacttcagaaatatcgacaaggtg
acattgggcaattatgagttccacacttggtatgggaacacggcctatttttcaagagca
aataatagccatccagaattgggtattaatactttagtaccgaggaaaaaacatttgggt
ggtgacccaacatcggacttttggcttaaaacactccatgtttgtgaatattgcttcaaa
tattgtgctgaaaaatcaagtatgagttcccaccggctggtttgtacaaaaaatactcca
tttcctcaaaccggccgccttgtatatagggatcccatctccaagtacgtgataaaacaa
gtacgagggtaccgacatcagttgttttgccaaaacttgtgtctttttgccaaactattt
cttgacgataaatcggtctattataacgttgatgcctatgaatttttcattatttacggc
catccagatacaggctcggaaatagaccgaaacatggttcctatgggctacttttctcat
gaattgggagcttgggacaacgataataatctagcttgcatctgtgtgtttccaccattt
caaaatcgacggcttggaacacttcttatagaccttctgtatgaggttccgcgagcccac
ggccaatcagaaccaactggaccggaatatccactcctgccgtttggaagggctacttat
ctacgttactgggccaagcgactagcgcacattctcctgtgctctttacaacgaaagaca
ctgttcacactacaagacttatctgatctcactggatttcgaaaagaagatatactattg
acattggagttcatgcaagtacttggcaagaaagttgtgctgcaaaatggtgaagaagaa
ggttgcaaacccgttcttctgcttgaaaatctccgccaatggtgtgtgagaaacagggtg
gaaacgagtcaggacatgagaatgctcaatcccgactacttggtgctatga

DBGET integrated database retrieval system