KEGG   Meyerozyma guilliermondii: PGUG_02717Help
Entry
PGUG_02717        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_02717
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_02717
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_02717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 801 aa AA seqDB search
MLRHRPAPGILISQSQIFNQYAIAAITMTCCDHISTFPIQKLTPGTQVHKDDCMYCFDTP
ENCPKGIDICLECYQSFSRGPLNHTELHVNSTHHQIYLNLVKELKPEDERKRKSDGERSV
KMAKLMITDSQEDDNYNTLTSIYCALCDLKCNMSEVSEGLQLKVDEIMNANSSTRSEEIK
AWEQEIFPCTHSCDIQQTVTDSPPDLSKCGACDLKQNLWICLHCGSIGCGREQFGSSIPG
NSHALAHYELTGHPVAVKLGSLSAAGSEICDSYCYKCNDEVKVPNVSACLLKFDIDVSKA
VKTEKSLVEINLDQNLNWDFKLDGANGEKLQPVFGSGLTGMKNLGNLCYLNSVVQSLFSL
NDYKSYFENKTFPPFKRVKDPSRDVCCQLVKMYDGLYSSRYSVPSQLSGDVYQAGIKPST
FKHLIGENHPEFQTQRQQDAYEFYLHLLDKIDNEVGLALNEGLKFVLDNKILCSKCNKGR
IDSELVDSLSVPIVDENTSDTEKVDILEKIEDYFAVEAVEDYQCDECKEKTVAFKSSGFK
TYPQSLVLNARRIQLKNWVPVKVDVELQVPDVIDLSSFGAPILEDGEQEFTKTNSTTFEP
NPDAMEMLSSMGFPHNRAAKALYNTGNKSAEDAMNWLFEHLEDADIDAPLEVSESKESNE
PSNEAIASLGAMGFSSQVSRKALILSKGDVNAAVEWLFSNPDDDGVIEVDRTKSTAEARL
SLMEKLTLAPATGGNYKLKAIVCHKGSSPHTGHYVAYIRLNIDNQERWVLFNDEKVVLCD
ESSMKEVGANGYLYFFEKIAH
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcaccgtcctgcaccaggaatcttaatttctcaatctcagatctttaaccag
tacgccattgctgccattaccatgacctgttgcgaccacatttccacattccctatccaa
aaattgactcctggcactcaggtgcacaaggatgattgtatgtactgcttcgatacacca
gaaaattgccccaagggtatagatatatgtctcgagtgctaccagtcattctctcgtgga
ccattaaatcacacagaattgcatgtaaacagtacccaccatcagatctacctcaatcta
gtcaaggagttgaagccggaagacgaaagaaagaggaaatccgatggagaacgcagcgtt
aaaatggctaaactcatgatcacagactcacaggaagacgacaattacaatacgctaaca
tctatatattgtgccttgtgtgacttgaaatgtaacatgtctgaagtttctgaaggtctt
cagctgaaagttgacgaaatcatgaatgcaaactcgtctactcggagcgaagaaatcaag
gcatgggaacaggaaattttcccttgtacacattcttgtgacattcaacaaaccgtcaca
gactcgccaccagatctctctaaatgtggtgcttgtgacttgaaacaaaacttgtggata
tgtctccactgtggttccattggttgcggtagagaacaatttggctcgtccattcctggc
aattcccatgcattggcacactacgaactcactggccatccagtagcggtaaagcttggc
tctctatcggctgccggctctgaaatctgcgactcttattgctacaaatgtaacgatgaa
gtcaaggttcctaacgtttcagcatgcttgttaaagtttgatatcgacgtttcgaaagcg
gtcaagacagaaaagagtctagttgaaattaaccttgatcagaacttgaactgggatttc
aaactcgacggcgccaatggagaaaagttgcagcctgtattcggctccgggttaaccggc
atgaagaaccttggaaacctgtgttacttgaactctgtcgtccagtcgttattcagcctt
aacgactacaagtcatactttgagaacaagacgtttccgcccttcaagcgtgtgaaagat
ccgtcgagggacgtatgctgtcaacttgtcaagatgtatgatgggctttattctagcaga
tattcggtgccatctcaactctctggagatgtataccaagcgggaatcaaaccatcaact
tttaagcatttaataggtgaaaaccaccctgaatttcaaacgcaacgacaacaagatgca
tacgagttttatttgcatttgctcgataagatcgacaatgaagttggcttagcacttaat
gaaggcttgaagtttgttcttgataacaagatcctctgttccaagtgcaacaaaggacgg
atagacagcgaacttgttgatagcttatcggtgcccattgtcgatgaaaatactagcgat
accgaaaaggtggatatactagagaagatagaggactactttgcggttgaggcagttgaa
gattatcaatgtgatgaatgtaaagagaaaactgttgcattcaaatcaagtggttttaaa
acttatccacaatctttggtgttgaatgcaagacgaattcagttgaagaactgggtgccc
gttaaagtggatgtggaacttcaggtgcccgatgtgattgatttgagttcttttggtgcc
ccaatactcgaagatggcgagcaagagtttactaaaacaaacagcacaacattcgaaccc
aatccagatgccatggaaatgttatctagtatgggctttcctcacaatcgagcggccaaa
gcactttacaatacaggcaataaatcagccgaggatgcaatgaattggctctttgagcat
ctcgaggatgcagacatcgatgctccgcttgaggtttccgagtcgaaagagtccaatgag
ccttcaaatgaagctattgcatccttaggagcgatgggattttcaagtcaagtttctcga
aaagcactcattttatccaaaggcgatgttaacgctgcggtagaatggcttttcagtaac
ccagatgatgacggagtcatcgaagtcgacagaactaaatctacagccgaggcaagactg
tcgttaatggaaaaattgactctggcaccagctacaggtggtaattacaagctcaaagct
atcgtttgtcataaaggttcatctcctcacaccggccactacgttgcatacattcgtctc
aacatcgataaccaagaaaggtgggtccttttcaacgacgaaaaggtggttctctgtgac
gaatctagcatgaaagaagtgggtgccaatggatacttgtacttctttgagaaaatcgcc
cattag

DBGET integrated database retrieval system