KEGG   Meyerozyma guilliermondii: PGUG_02732Help
Entry
PGUG_02732        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MFTNTVSIKNSGKVYEIDVDSSTSGSQFKEKIFGITNIPVDRQKILIKGGKIDDSKPIEE
QVSSQKQPIMVLGNPAPAVPSEPVEKQVFLEDLNPNLLIKVSNEPSGLVNLGNTCYLNSS
LQALFQIDDIASKVANYKSPNGINSTSNESLTASLRATFDQMQKKQERVNPMLFLTLFRN
VFPQFAEQDHGFYKQQDAEEAFLQLLTILDQTLKVGDNFRLSYKKEQKCLALPDEAATVD
YEDSLKLNCHIDIKTNFLRDGILSGLKETIEKYNDTLQSNTEYEISRTITRLPKYLTVHF
MRFFWRRDTQKKSKILRRVQFPFELDLAEMLDSSIKNDKVAVRDKIRQIEKDQDELIRDF
KKSKKSSGLNPTEQEEEDQMKIESIKSKFRDDLSSALPGMSLDSTTENPSSVYQLGAVIT
HAGSSADSGHYQAYVRDPKDIEGIRWWKFNDDKVSEVSREKVETLAGGGEADSALILIYK
GVGL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttcactaatacagtttcgatcaaaaattcgggcaaagtatatgagatagacgtggat
tcgagcacctcaggctcccaattcaaggagaagattttcggaatcacaaacattcccgtt
gatagacaaaaaatcttgattaaaggaggcaaaatcgatgattctaagccaatagaagag
caggtttcgagccagaaacaaccaattatggtacttggaaaccctgctccggctgtgcct
tcagagcctgttgaaaagcaagtttttctcgaagatttgaacccaaatctgttgataaaa
gtgtccaatgagccatcaggattggttaatttgggaaatacatgctacttaaactcatct
ttacaagcgttgtttcaaattgatgatattgcgagcaaggtggcgaattacaagtctcca
aatgggataaacagcacatccaacgaatcgttgaccgcgtctttgcgggcaacattcgac
caaatgcagaaaaagcaggaaagggtgaatcctatgttgtttctcacgttgtttcgtaac
gtctttcctcagtttgcagaacaagatcatggtttctacaagcagcaagatgctgaggaa
gccttcctgcaacttttgacaattctagaccaaacgttaaaggtgggtgacaacttccgg
ttgtcttataagaaggaacagaaatgtttggcgcttcctgatgaagccgccacggtagat
tacgaagattcgttgaaattgaattgtcatattgacatcaaaactaactttttgagagat
ggcattttgagtgggttgaaggaaacaatcgaaaaatataacgatactttacagtctaat
accgagtacgagatctctcgtacaatcaccagacttcccaagtatctcactgttcatttc
atgcgattcttctggaggagggacacgcagaagaaatccaagatcttgagacgagttcag
ttccctttcgaactcgatttggccgagatgttggattcttcgataaagaatgataaagtt
gccgtccgtgataaaatcaggcaaatagaaaaggaccaagacgagttaataagagatttc
aaaaagtccaagaagtcgtctgggctcaatcctacagagcaagaggaagaagaccagatg
aagatagagtcaatcaagtccaagttcagagatgacctttcttcagcattaccaggaatg
tcgcttgattccacaaccgagaacccatcatcggtgtatcagcttggggcagttatcacc
catgctgggtcatcggcggattctggacattaccaagcatatgtaagagatcctaaggat
attgaaggcatcagatggtggaagttcaatgacgacaaagtatctgaggtgagtagagaa
aaggtggagacattggccggaggcggcgaggcagacagtgcattgatcctcatatacaaa
ggtgtcggtctttaa

DBGET integrated database retrieval system