KEGG   Meyerozyma guilliermondii: PGUG_02769Help
Entry
PGUG_02769        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PGUG_02769
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PGUG_02769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 319 aa AA seqDB search
MPSITVVGSLNYDLVTYTNKVPGPGETYQAISFENHLGGKGLNEALAASRLSAPNSTTNI
RMVGNIGEDSFGKEPKQALVDSNVNVDYVKEIKGISSGVAVILVETNGENRILITAGANG
ELKPTEEEYQSIFSETEDGDYVILQNEYPDTFKTISWLKANKPRVNIAYNPSPFKEEIAD
PEIMKQIDLLIVNEGEAADIARTLNLNEKTEESVDNMKKLASALQRKLHQSNCSSAIITM
GGQGCCYSTKEGASFTPASKVENIVDTTGAGDTFFGGIVLQLAQKSSLQDAVSFATKASA
LAIQRKGAAEGIPWFNDIK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgccttccatcacagtagtagggtccctaaactacgacctcgtcacctacaccaacaag
gttccgggtccgggcgagacgtaccaagccatttcgtttgaaaatcacctaggaggaaaa
ggtctcaacgaggcgttggcggcctctcgtctatcggcgccgaattccaccacgaacatc
agaatggttggaaatatcggtgaagattcgtttggcaaggaacccaagcaagccttggtc
gattccaacgtcaatgtagactacgtgaaagagatcaaaggaataagttcgggcgttgct
gtcattcttgttgagacaaatggagagaatcgcatcttgattacagcgggtgcaaatggt
gaattgaagccaaccgaagaagagtaccagtcgatattttccgagacggaagatggcgac
tatgtgattctccaaaacgaatatccagacactttcaagaccatttcgtggttgaaggcc
aataaacccagagtgaatattgcctataatccttccccatttaaagaagaaattgccgac
ccagagatcatgaaacaaatagatttgctcattgttaacgaaggggaagccgctgatatt
gccaggaccctcaatttgaacgaaaaaacggaagaaagtgtggataatatgaaaaagttg
gccagtgcgttgcagagaaaattgcaccagtccaactgtagcagtgccataattaccatg
ggcggccagggatgttgctattccactaaagaaggggccagcttcacaccagcatcaaaa
gtggaaaatattgtcgatacaacgggcgcaggagacacgtttttcggaggcatagttctg
caattggcacagaaatcttcactacaagatgctgtttcgtttgctacaaaagccagtgca
ttggctatccagagaaaaggtgcagcggagggcataccttggtttaacgatatcaaataa

DBGET integrated database retrieval system