KEGG   Meyerozyma guilliermondii: PGUG_02777Help
Entry
PGUG_02777        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PGUG_02777
   00500 Starch and sucrose metabolism
    PGUG_02777
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PGUG_02777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
AA seq 514 aa AA seqDB search
MRAFLALIFLTFVMNVESSRPLMAFTPSHGWMNDPNGQFYDSKNELWHLYYQYNPNDTVW
GTPLYWGHATSKDLSTWKDYGATIGPDRDEDGIFSGNIVVDHNNTSGFFNDSIDPRQRVV
AIYTYNTEGSQTQHVAYSLDGGYTFEKYEHNPVLDVDNINFRDPKVFWHEPTNQWIMVIA
LSQQFKIQIYGSIDLTNWSLHSNFTGGLFGFQYECPGLIEVPVEGTDELKWVMFIAINPG
LPLGGSSNQYFIGSFDGFEFVPDDSQARLMDYGKDFYAFQTFDNAPKELGVVGLAWASNW
QYANLAPTKEWRSSMTLARQMTLASRNMNPETKVLSLLQKPIFGESVVAANKISKRNITG
QDEQAVKIHKNSTGTFLFDITFSVDLLKNQTGQLQVISGQNGESIRAGFDPTAGQFFVDR
GNTSGLKENPFFTDKTSAYVEPWKHQNDLPVYKMFGVIDGNLIEVFLNDGIATLTNTFFI
PGTEGLEYLEIESSSDAIHIVELEVKELKLRATS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttttcttgccttaattttcctcaccttcgttatgaacgtggaatcaagtaga
cccttgatggcattcacgccaagccacggctggatgaatgatccgaatggacaattctac
gattccaaaaatgaactctggcacttgtactaccagtacaatcccaacgacacagtatgg
ggaacacctttgtactggggccatgcaacttccaaagacttgtcgacctggaaggattat
ggtgcgactattggacccgatcgtgacgaagatggaatcttttctggaaacattgtggtt
gaccataataacacttctggttttttcaacgactcaattgaccccagacaaagagtggta
gcaatttatacgtacaataccgaaggttctcaaactcaacatgttgcgtactcgcttgat
ggagggtacacttttgaaaagtatgaacataatccggttttggatgttgataacatcaac
tttagagaccccaaagtgttctggcacgagccaactaaccagtggatcatggtgatagct
ttgagtcagcaatttaagattcaaatttatggctcgatcgacttgacgaactggagcttg
cactccaattttactggaggactctttgggtttcaatatgagtgtcctggactcattgag
gttcctgttgaagggactgatgagctgaaatgggttatgttcattgcaatcaacccaggg
ctgcctttgggtggttcgtccaaccagtatttcattggctcatttgacggatttgagttt
gtaccagacgactcccaagccagacttatggattacggcaaggatttctatgcttttcaa
acatttgataatgctcccaaagaactgggtgttgttggcttggcatgggcttccaattgg
cagtatgcaaatcttgcacctacaaaagagtggagaagttccatgacattggcacgtcaa
atgacattagcatctcgaaacatgaacccggaaaccaaggttttgtcgttacttcaaaaa
ccaatttttggcgaaagtgtggtggctgcaaataaaatttcaaaacggaatattactggt
caagatgaacaagccgtaaaaatccacaagaattccaccggtacttttctgtttgatatc
acttttagtgttgatctgctgaagaaccaaactggtcaactacaggtgatttctggtcaa
aatggtgagtccattagggcaggatttgatcccacagctggtcaatttttcgtggatcgt
ggaaatactagcggattaaaagagaatcctttcttcaccgacaaaacttcggcttatgtc
gaaccttggaaacaccaaaatgatttgcctgtttataaaatgtttggagtgattgatgga
aatttgattgaggtctttttgaacgatggtatcgcgaccttgaccaacacatttttcatt
cctggtactgagggacttgagtatcttgagattgagtcttctagtgatgccatccatata
gtggagctggaggtgaaggagttaaaattgagggcaacttcatag

DBGET integrated database retrieval system