KEGG   Meyerozyma guilliermondii: PGUG_03026Help
Entry
PGUG_03026        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PGUG_03026
   01230 Biosynthesis of amino acids
    PGUG_03026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGUG_03026
   00030 Pentose phosphate pathway
    PGUG_03026
   00051 Fructose and mannose metabolism
    PGUG_03026
   00052 Galactose metabolism
    PGUG_03026
  Energy metabolism
   00680 Methane metabolism
    PGUG_03026
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    PGUG_03026
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PGUG_03026
Protein phosphatases and associated proteins [BR:pgu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PGUG_03026
Messenger RNA biogenesis [BR:pgu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PGUG_03026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 984 aa AA seqDB search
MPSVNGISSISFVTTDPAELEAACKFYTSLGLRLTRSYPKNTSGFSSCPEYHLGVSSDSI
QEIWFESFPLQDTDKNGCLIPWQELPIYTGDKSAKLSQLFVIKIRLSGSLQITACSSKTN
SQTLGFFSTDLAKIKATIDVKQLDDDLYSAIDPLGNTLVFSNAENPFSSQHYSSPEEFLR
QKQEKILSSMKQSTSSLADAPVEELVKKKKIAIMTSGGDAPGMNPAVRAVVRAGIYHGCD
VFAVYEGYEGLVKGGDLLKQMEWNDVRNYLSLGGTNIGTARSARFREREGRLLAAYNMIR
NGIDALVVCGGDGSLTGADLFRSEWPLLTQELIDTGKLTKKEVEPYKHLTIVGLVGSIDN
DMSQTDATIGAYSSLERISEMVDYIDATALSHSRAFVVEVMGRHCGWLGLMSGLATGADF
IFIPERPPKAGQWKQELTETCHRHRQKGKRKTIVIVAEGAIDDQLNPISSDDVKQVLVDL
GLDTRTTILGHVQRGGTAVAYDRMLATLQGVEAIKAVLEASPEIPSPMIGIVENKIVRLP
LMDAVKATKSVAEAIENKDFDRAMELRDSHFADAYENYLSTTLHDDGSHLLPEKERLNIG
IIHVGAPSAGFNSATRAAALYCLSKGHQLYAIQNGFSGFIKEGLAKRLSWLDVEGWHNEG
GSEIGTNRSLPSEDFGTVAYFFQKYRLNGLIIIGGFEGFTALHQLDAKKKDYPVFNIPMV
VVPATVSNNVPGTEYSLGSDTCLNQLVKYCDAVKQSASSSRRRVFVVEVQGGHSGFVASY
CGLVTGSIATYTPESQINLRTLQEDIQLLFQVFEDDRGEDHNGKMIIRNEQASSVYTTEL
IADMIKEAAKGRFETRTAIPGHVQQGFGPSSVDRVNAVRLLVKSVQFIEQWNTQLRQVDE
DMELANMYKQTEELLRDLKSCKFSASAVVIGILGAGIEFTCIRDLFENEADVELRKGRSV
HWGEMAKAGDMLSGRSLLRNKSKR
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgccatctgtcaacggcatcagttcaatttcatttgtcaccacagacccagcagagctt
gaggcagcatgcaagttctatacctcgcttggattgcgtcttactagatcctatcccaaa
aatacttctggtttctcgtcctgtcccgaataccatctcggagtttccagcgattctatc
caagaaatttggtttgaatcatttcctcttcaagataccgacaaaaatggctgcttgata
ccttggcaagaacttccaatttatactggcgacaaaagtgccaaattgtcccagctgttc
gtgatcaagatcagactctcggggtcactgcaaatcaccgcgtgctcctccaagaccaat
tcacagacattggggttcttttccacggatctcgccaaaattaaggccaccattgacgtt
aagcaactcgatgatgatttatactcggcgattgatccacttggaaacactcttgttttc
agcaatgcagaaaatccattttcaagccagcactattcgtcccccgaggaatttcttcgt
cagaaacaggagaaaattctatcctctatgaagcaaagcacatcttcgctcgcagatgcg
cccgtggaagaacttgtaaagaagaagaaaattgcaatcatgacttcgggtggtgatgct
cctggaatgaacccagctgtccgtgcggtggtacgtgccggtatttaccatggatgtgat
gtttttgctgtgtacgaaggatacgaaggattggtgaagggcggagatttattgaagcaa
atggagtggaacgatgtgagaaattatctttctcttggtggtaccaacattggaaccgcc
agaagtgctcgtttccgtgaaagagaaggtcggttgctcgctgcctacaatatgattcgc
aatggtattgatgcgttggtggtttgtggaggtgatggttctcttactggtgcagacttg
ttccggtccgaatggccgctgttgacccaagagcttatagacaccggcaaattgaccaag
aaagaagtggagccttataaacatctcacaattgtgggattagtgggttccattgacaat
gacatgtcgcaaaccgatgctactattggtgcatattcctcattggaacgtatatctgaa
atggtggattatatcgatgccacagcgctgtcacactctcgagccttcgtggtagaggtt
atgggacgacactgtggatggctaggattgatgtctggacttgcaactggtgcagacttt
atcttcattcctgaaagaccaccaaaagcaggacaatggaaacaagaattgacagaaact
tgtcaccgtcatagacaaaagggaaagcggaagacaatagttatagtagctgaaggagct
atagacgatcagttgaaccccattagttcggatgatgtcaaacaagtgttggttgatctc
ggattggacactagaaccacgatattgggccatgttcaaagaggaggtactgctgtggct
tacgatagaatgcttgcaacattacaaggagtggaagccattaaagctgtattggaagca
tcgccagaaattccttctccaatgattggaattgtcgaaaataaaatcgttcgtctgcct
ttgatggacgcagtaaaagcaacaaaatccgttgctgaagccatcgagaacaaggacttt
gatcgtgcgatggaattgcgtgatagccactttgctgatgcctacgaaaattatttgagc
acaactcttcatgacgacggctcgcatctccttccggagaaagaaagactcaacattggt
attattcatgttggagctccttctgcgggattcaattctgcaacgagagcagcggcattg
tactgtttgtctaagggacatcagctctatgccattcaaaacgggttttctggtttcata
aaggaaggtcttgcgaagcgtctaagctggttagatgttgaaggatggcataatgaagga
ggatcggaaattggaacaaataggtctttacccagtgaagattttggaactgtggcatac
ttctttcaaaaatatcgtctcaacggtttgattattatcggaggttttgaaggtttcact
gcattgcatcaattggacgctaagaagaaagactaccctgtgttcaacattcccatggtg
gttgttcccgctactgtatccaacaacgttccaggaaccgagtattcgcttggaagtgat
acatgtttgaaccagttggtgaaatactgtgatgccgtcaagcaatcagcatcgtcgtcg
cgcagaagagttttcgtggttgaggttcaaggtggacattctggattcgttgcttcatac
tgtggcttggtaactggctctatagccacctacactcccgaatcacagataaacttgcgt
acgcttcaagaagatattcaacttttattccaggtgtttgaagatgatcgtggtgaggac
cacaatggtaaaatgatcattcgtaatgagcaagcatcctcggtctacactaccgaatta
attgctgatatgatcaaggaagctgccaagggccgttttgaaaccagaactgccatccct
ggtcatgttcaacaaggcttcggaccatcatcggttgatagagtgaatgcggtgagatta
ctggttaagtctgttcaattcatcgagcagtggaatactcaattgcgtcaagttgatgaa
gatatggagcttgcaaacatgtacaagcaaactgaggagcttttgagagatctgaaatcg
tgcaagttttctgctagtgccgtagttattggcattcttggagctggcatcgaatttact
tgcattagagatttgtttgaaaatgaagcggacgttgaattacgaaagggtcgttcggtt
cattggggagaaatggctaaagcgggagacatgttgagtgggcggtctctacttcgaaac
aaaagcaaacgctaa

DBGET integrated database retrieval system