KEGG   Meyerozyma guilliermondii: PGUG_03041Help
Entry
PGUG_03041        CDS       T01150                                 

Definition
similar to GTP-cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pgu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 261 aa AA seqDB search
MVDTPKQEPKTPKPLASIQKSRLLSEGDGIDRSGTPLRTRVASPCTLNPPIDSDGLSWPS
LGARQRIEQTEEESKSRELRIAGAVRTILTELGEDPDREGLLETPERYARAMLFFTKGYE
DNIRDVIKRAVFEEDHDEMVIVRDIELYSLCEHHLVPFFGKAHIGYIPNKRVLGLSKLAR
LAEMYCRRLQVQERLTKQIAMALNEMLQPRGVAVVIEATHMCMVSRGVQKTGSSTTTSCM
LGCFRNQQKTREEFLTLLGRK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggttgacacgccaaaacaggaacctaagacccctaaaccgttagcttcaatccagaag
tcgagattgctctctgaaggtgatggcatagaccggtcgggtactcctcttagaacgaga
gttgcttctccatgcactttgaatcctccgattgacagtgatggactttcatggccatct
ttaggtgcaagacaaaggatagagcagaccgaagaggagtccaaatcaagggagctccgt
atagctggtgccgttcgtacgattttgacggaattgggtgaagatccagatcgtgaagga
ttgttggaaactcccgaaagatatgctcgagccatgttgtttttcaccaaaggatatgag
gataacattcgagatgtgatcaaaagagctgtgtttgaagaggatcatgacgaaatggtt
attgttcgtgatattgagctctactcattgtgtgagcatcacttggttccatttttcggt
aaggctcatatagggtatattcccaacaaaagagtgcttggattgtcgaagcttgcccgg
ttggcagaaatgtactgccggcgtcttcaggtccaagaaagactcacaaaacaaattgca
atggcactcaatgagatgttgcaaccgcgcggagttgcagtggtaatcgaagcaactcac
atgtgtatggtgagtagaggagtgcagaaaactgggtcttccaccaccaccagttgcatg
cttggctgtttccgtaatcagcagaaaacgagagaggaatttttgaccttgctaggcaga
aagtag

DBGET integrated database retrieval system