KEGG   Meyerozyma guilliermondii: PGUG_03068Help
Entry
PGUG_03068        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00220  Arginine biosynthesis
pgu00330  Arginine and proline metabolism
pgu01100  Metabolic pathways
pgu01110  Biosynthesis of secondary metabolites
pgu01130  Biosynthesis of antibiotics
pgu01230  Biosynthesis of amino acids
Module
pgu_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    PGUG_03068
   00330 Arginine and proline metabolism
    PGUG_03068
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PGUG_03068
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5126552
NCBI-ProteinID: XP_001485339
UniProt: A5DIG7
AA seq 280 aa AA seqDB search
MNAGFEKQIANLGWDVKVENPLDDTSFEDKKTDDKDQYGVKNAAIVSECCQKIYNAVNNS
VASGRLPITIGGDHSIGTATVAGTMAARPDTCVLWIDAHADINTPQTTESGNLHGCPMSF
VMGLDKDSYPPEFSWVPQCLKPNKIAYIGLRDVDDGEKRILRENNIPAFSMYHIDKYGIG
KVVEMALDKINPDRSAPIHLSYDVDAIDPSFVPATGTRVEGGLTLREGLFVAEAVAETGL
LSSMDIVETNPLLGQTDAHILDTVSAACAIGRCALGQTLL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctggatttgaaaagcagatcgccaatcttggctgggatgttaaggttgagaac
ccattagacgacacttcgttcgaagacaagaagaccgatgataaagatcaatacggtgtc
aaaaatgctgcaattgttagcgaatgttgccaaaagatttacaatgccgtcaacaactct
gttgccagcggaagacttccaataactatcggaggagatcattctattggcaccgctact
gtggcaggaaccatggcggctcgtccagatacttgtgttttgtggattgatgcccatgcg
gatatcaacactcctcaaaccaccgagtctggaaacctccatggatgccccatgtcattc
gtgatgggactcgacaaggatagctacccacctgaattctcatgggttcctcaatgtttg
aaaccaaacaaaatagcttatatcggcttgagagatgttgacgatggagaaaagcgtatt
ttacgtgaaaacaacatcccggcattttccatgtaccacattgacaaatatggaataggt
aaagtggtggagatggctcttgacaaaattaatcctgaccggtctgctcccatccatttg
tcttacgacgtcgatgcaattgacccatcatttgttcccgcgaccggtactagagtagaa
ggaggacttactttaagagagggtttatttgttgctgaagccgtggcagaaactggtctt
ttgtcgtcgatggatattgtggaaaccaaccctcttttgggccaaactgacgcccatatc
ttggacaccgtcagtgcagcctgtgccattggtcggtgtgctcttggccaaacattgttg
tag

DBGET integrated database retrieval system