KEGG   Meyerozyma guilliermondii: PGUG_03442Help
Entry
PGUG_03442        CDS       T01150                                 

Definition
(RefSeq) similar to histone H2b
  KO
K11252  histone H2B
Organism
pgu  Meyerozyma guilliermondii
Brite
Chromosome and associated proteins [BR:pgu03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    PGUG_03442
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_03442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W DUF3391
Motif
Other DBs
NCBI-GeneID: 5126025
NCBI-ProteinID: XP_001484061
UniProt: A5DJJ1
AA seq 129 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDSKKRTKTRKETYSSYIYKVLKQTHPDTGISQK
AMSIMNSFVNDIFERVASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEATRT
ITKYSSAAN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagcagaaaagaaacccgcttcaaaggctccagctgagaagaagccagct
gccaaaaagactgcttcgactgactccaagaagaggaccaagacaagaaaggaaacatac
tcttcgtacatatacaaggtcttgaagcaaacacacccagatactggtatttcccagaag
gctatgtctatcatgaactctttcgtaaatgacatctttgagagagtcgcttccgaagct
tcgaaattggctgcctacaacaagaagtcaactatttctgctagagagattcaaactgcc
gtgagattgatcttgcctggtgagttggctaagcacgctgtttctgaagctactagaact
attactaaatactcatctgctgccaattag

DBGET integrated database retrieval system