KEGG   Meyerozyma guilliermondii: PGUG_03442Help
Entry
PGUG_03442        CDS       T01150                                 

Definition
similar to histone H2b
Orthology
K11252  
histone H2B
Organism
pgu  Meyerozyma guilliermondii
Brite
Exosome [BR:pgu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PGUG_03442
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MAPKAEKKPASKAPAEKKPAAKKTASTDSKKRTKTRKETYSSYIYKVLKQTHPDTGISQK
AMSIMNSFVNDIFERVASEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEATRT
ITKYSSAAN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaaagcagaaaagaaacccgcttcaaaggctccagctgagaagaagccagct
gccaaaaagactgcttcgactgactccaagaagaggaccaagacaagaaaggaaacatac
tcttcgtacatatacaaggtcttgaagcaaacacacccagatactggtatttcccagaag
gctatgtctatcatgaactctttcgtaaatgacatctttgagagagtcgcttccgaagct
tcgaaattggctgcctacaacaagaagtcaactatttctgctagagagattcaaactgcc
gtgagattgatcttgcctggtgagttggctaagcacgctgtttctgaagctactagaact
attactaaatactcatctgctgccaattag

DBGET integrated database retrieval system