KEGG   Meyerozyma guilliermondii: PGUG_03454Help
Entry
PGUG_03454        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PGUG_03454
Enzymes [BR:pgu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PGUG_03454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 364 aa AA seqDB search
MLRALYLIFLLVLYVLGGSVVLANDKTFKEVVHDSNKYTFVEFYADWCRHCGKLSPVLDT
VASMFDNEPNVQIVKVNGDKDGRKMSKKYVLQGYPTMLFFHGDNDPVEYNGGRDEISISN
FIQQMSNIRLGDKSEQEGDEISKLMRISDENIEAQVLHSPSKTLALFTSSHCKSCTRVRA
DFENLATWYARDKQVIQFAEIDLDINSDKIQEQFSITSAPAILLFDPEYVNEDGLKAPQL
YSGRFDVSSINNYINGVTGISRTNEGKLTNEAGILTQLREKVKSLNSLDDKVAAGMSILS
DIRTLTAQVGPVDTRMLPYYRHLTIQAMNGNYDQFQAEFKRLETIADSNEGIKLMLNVLQ
EFLS
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctccgagccttgtacttgatcttccttttggtgctgtatgttttaggaggctcagtg
gttctagcaaatgataagacattcaaggaagtagttcacgattccaataagtacacattt
gtggagttttatgccgactggtgccgccactgcggtaagctttcaccagttttggacact
gttgctagcatgtttgacaatgaacctaacgtccaaatagttaaggtcaatggtgataag
gatggtcgtaaaatgtcaaagaaatacgttcttcaaggctacccaactatgttgttcttt
catggagacaatgatccagtagagtataacggaggacgagatgaaatctcgataagcaac
tttatccaacagatgtccaatattcgcttgggcgacaaaagcgaacaagagggcgatgaa
atttccaagttgatgcgtatatcggacgagaacatcgaggctcaggtgcttcattcacca
tccaaaacacttgctttgttcacctcatcccattgtaaaagctgtactcgcgtacgagcc
gactttgagaacctagccacctggtatgcgagagacaaacaggtaattcagttcgccgaa
attgatctcgatatcaactccgacaaaattcaagagcagttttctataacttctgcgcca
gccattttactttttgatcccgaatacgtcaatgaagatggattgaaggccccgcagttg
tattctggtcgctttgatgtatcttccatcaataactatatcaatggagtaaccggtatc
tcgcgaacgaatgaaggaaagttgacaaatgaagccggtattctcactcaacttcgagaa
aaagtcaaatctcttaattctctggatgacaaagttgccgctggaatgtccatcttgagt
gatattcgaaccttgacagcgcaggtgggacctgtggatacccgcatgcttccttactac
agacatttgaccatacaagccatgaatggaaactacgatcagtttcaagctgaatttaaa
cgacttgaaaccattgccgattctaatgaaggtattaaacttatgttaaacgtgcttcaa
gagttcttgagctga

DBGET integrated database retrieval system