KEGG   Meyerozyma guilliermondii: PGUG_03476Help
Entry
PGUG_03476        CDS       T01150                                 

Definition
similar to 2-oxoglutarate dehydrogenase complex E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pgu  Meyerozyma guilliermondii
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pgu01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pgu00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pgu00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MLSRSIKRSMSHLPRAGNMAKVSMARNLTLGAKTGLRPALIAGVQSGFKVSTPMGMSFKR
FASQTVKVPEMAESITEGTLASYSKSVGDYVEQDETIATIETDKIDVEVNAPVSGTITEL
LVEVEDTVEVGQELLKIEEGAAPEGGAAKKEEPKEEKKEEPKEEKKEEKKEEPKESKPEP
KKEEPKKEPKKESKSEPKKDSKSQDPVSFTNFSRHEERVKMNRMRLRIAERLKESQNTAA
SLTTFNEVDMSNLMEMRKLYKDEFLEKTGIKLGFMGAFAKASCLAAKDVPAVNAAIENND
TLVFRDYTDISVAVATPKGLVTPVVRNAESLSILEIEQEISKLGKKARDNKITLEDMTGG
TFTISNGGVFGSLYGTPIINMPQTAVLGLHGVKERPVTVNGQIVSRPMMYLALTYDHRVL
DGREAVIFLRTIKELIEDPRKMLLMQ
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccagaagtataaaacgcagcatgagccacctcccacgtgcgggaaacatggct
aaagtgtccatggcccgtaatcttactttgggtgccaaaactggtcttcgtcctgccttg
atcgccggggtccaatctggcttcaaagtgtccactcccatgggaatgtccttcaaaaga
tttgcatcgcaaaccgtaaaggttcctgagatggcagagtccatcaccgagggtactttg
gcatcttacagcaaaagcgtcggagactatgtcgaacaagatgagaccattgctaccatt
gaaaccgacaagatcgatgtagaggtcaatgctccagtttccggaactattaccgagctt
cttgttgaagttgaggacaccgtggaggttgggcaagagcttttgaagattgaagaaggt
gccgcacctgaaggtggagctgctaagaaggaggagccaaaggaagagaagaaagaggag
ccaaaagaagagaagaaggaggaaaagaaagaagaacctaaggaatcaaagcccgagcct
aagaaggaagagccaaagaaggaaccaaagaaggaatccaagtctgagcctaagaaggac
tccaagtcgcaagatcccgtttctttcaccaacttttctagacacgaggagagagtcaag
atgaacagaatgagattgagaatcgccgagcgtcttaaggaatctcaaaacaccgctgct
tctttgaccactttcaatgaagtcgacatgtccaacttgatggaaatgagaaaattatac
aaggatgaattcttggaaaaaaccggaatcaagcttggtttcatgggtgcattcgccaag
gcttcgtgcttggctgccaaggacgttcctgccgtcaatgctgccattgaaaataacgac
accttggtgttcagagactacactgacatttctgttgctgtggccactccaaagggtttg
gttaccccagttgtcagaaacgccgaatcgttgtctatcttggagattgaacaagagatc
tcaaaattgggtaagaaggcccgtgacaacaagatcaccttggaggatatgaccggtggt
acctttaccatctctaacggtggtgtgtttggttctttgtatggtactcctatcatcaat
atgcctcaaactgccgttttaggtttgcatggagtcaaagagagaccagtaactgtcaat
ggtcaaattgtttcgagaccaatgatgtacttggctttgacttacgaccacagagttttg
gacggacgtgaagccgtcattttcttgagaactatcaaggaattgattgaggacccaaga
aagatgttgttaatgcaatag

DBGET integrated database retrieval system