KEGG   Meyerozyma guilliermondii: PGUG_03489Help
Entry
PGUG_03489        CDS       T01150                                 

Definition
extracellular signal-regulated kinase 1
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 357 aa AA seqDB search
MDQDQPLQQPQVRQISFNVSDHYQILEVVGEGAYGVVCLAIHKPTNQKVAIKKIEPFERS
MLCLRTLRELKLLKHFSHENIISVLAIQVPLNYESFREIYFIQELMETDLHRVIRTQKLS
DDHVQYFIYQTLRALKAMHAANVLHRDLKPSNLLLNSNCDLKICDFGLARSVALTEDNFG
FMTEYVATRWYRAPEIMLTFLEYTTAIDVWSVGCILAEMLTGRPLFPGRDYHNQLWLIME
VLGTPNMEDYYNIKLKRAREYIRSLPFCKKIPFNELFANANPLAVDLLEKLLIFNPAKRI
TVEDALDHPYLKLYHDPTDEPLAEKIPDDFFDFDRRKDELTIEDLKKLLYEEIMKPL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaccaagaccagccgttacagcagccccaagtccgccagatctcgttcaatgtatca
gaccattaccagatcttggaagtggtgggcgagggtgcctatggtgtggtgtgcctggcc
atccacaaacccaccaaccagaaggtagcgatcaaaaagattgaaccttttgagcggtcg
atgttatgtctccggacacttcgtgagctcaagctcctcaaacacttttcccatgaaaac
ataatctccgttcttgccatacaagttccactcaattatgaatcatttcgtgaaatatat
tttattcaggaactcatggaaacggacttacatcgagttattcgtacacagaaactctcc
gacgaccacgtacaatacttcatctaccagacacttcgtgctctcaaggcgatgcatgct
gccaatgttcttcatcgtgatctcaaaccaagtaacctacttttgaactccaactgtgac
ctcaagatttgtgattttggccttgcgaggtcggtggcgctgacagaggacaatttcggg
ttcatgaccgagtacgtggccactaggtggtaccgagccccggaaatcatgctcacgttt
ctggagtataccactgcaatcgatgtatggtcagtggggtgtattctcgcagaaatgttg
acgggacggccattgtttcctggtcgtgactatcacaaccagctctggctcatcatggag
gttttgggcactccaaacatggaagactactataacatcaaactgaagcgggcacgtgag
tatattcggtctcttccattttgcaaaaaaataccgttcaatgagttgtttgccaacgcc
aatccattggcagtggatctcttggaaaaactcctcattttcaacccagcaaaaagaata
accgtggaagatgctctcgaccacccatacttaaaactctaccatgatcctaccgacgaa
ccgctggcggaaaagatccccgacgactttttcgactttgatcgccgcaaggacgaattg
accattgaggacttgaagaagttgttgtacgaagaaatcatgaaaccattatag

DBGET integrated database retrieval system