KEGG   Meyerozyma guilliermondii: PGUG_03508Help
Entry
PGUG_03508        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
pgu  Meyerozyma guilliermondii
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:pgu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 367 aa AA seqDB search
MSYLGTSSGPTTATAATGKELLNDVTVNNPPEDSVSDLSFSPTQDMLAVASWDKKVRIYD
IDPYSGNNQGKAMFEHEAPVFSAQWSIDGTRVISGGADKQVKLFDLASQQAQQIGVHDAP
VSSVRYVECGPTNAQVVVSGSWDKTLKYWDMRAPQPVSTITLPERVYSMDTTQKLLVAGC
ADRHICIVDLNNPQQLFKTYPSPLKWQTRIIKCFPQADGFAIGSLEGRCAIQYIDEAKQK
ELGFVFKCQRKVTNPPGTLGLRTNSNSESDIYAVNAVQFHPIYGTFSTAGSDGTFSFWDK
DAHQKLKSFPNVNGTISCTGFNRNGSIFAYAVSYDWSQGHMGNRPDYPITIKLHPVKDEE
IKQKKKK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcttatttaggtacatcttctggacccaccacggccaccgcggccacaggaaaggag
ctactcaatgatgtgactgtgaacaatccaccagaggattctgtgagcgatttatctttt
tctcctacacaagatatgttggcagttgcaagttgggacaagaaggttcgaatttacgac
attgatccctatagtggaaataatcaaggaaaagcaatgtttgagcatgaagctccagta
ttttccgcgcagtggtcaattgatggaaccagagtcataagtggtggtgctgataagcag
gtgaaactctttgatttggccagtcaacaagcccagcaaataggtgttcatgatgctcca
gttagctccgtaaggtacgtcgagtgtgggccaactaacgcacaggttgtggtgagtggc
tcgtgggataagactttgaaatactgggatatgagagctcctcagccggtgtccaccatc
actcttcctgagagagtatactcgatggatactacgcaaaaactcttggtagcaggctgc
gcagaccgtcacatctgtattgttgaccttaataatccacagcagcttttcaagacgtat
ccatctccattgaaatggcagaccagaattatcaagtgctttccacaagctgatggtttt
gccattggttcgctcgaaggaaggtgtgccatccaatacatagacgaggccaaacaaaag
gagcttggattcgtattcaagtgtcaaagaaaagttaccaacccgcccggaacccttggg
ctgcgcaccaacagtaacagtgaatccgatatctatgctgtcaacgccgttcagttccat
cctatttatggtacattttctacagccggaagcgatggtactttcagtttctgggacaaa
gatgcccaccaaaaattgaaatcattccccaatgtgaacggtaccatttcatgcaccggg
tttaaccgaaacggctcaatctttgcttatgctgtgagttacgactggtcccagggacat
atgggaaaccgtccggattaccctattacaattaaattacatccagtcaaggacgaagag
atcaagcaaaagaagaagaagtag

DBGET integrated database retrieval system