KEGG   Meyerozyma guilliermondii: PGUG_03554Help
Entry
PGUG_03554        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_03554
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_03554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1280 aa AA seqDB search
MTPDFEDKENLNLGAKGAVPPNADLIYVDLMEEDDESAEQIVIDEEDDDEEDEDDQEMAE
DTEPVTRRATAPDPRLTAIPKANEFEKLAKRLMKPLPDYPVADETHHVWTIDSWSSLREN
KIRGPTFKCGGYEWNVLLFPRGNNNTHISIYLEPHKILDDKNMRADDWYVCAQFALDIWN
PSYPECHLPSGSFHRFNKNETDWGFSTFIDLGQLNSTRRFNNGHAILEKNTLNITAYVRI
IDDSSTGVLWHSFLDYDSKASTGYVGLSNQGATCYLNSLLQSYYTTKIFRDLVYQIPTET
HKKGQSVSLELQRIFYLLLTSSEAVGTLELTKSFGWDSSEAFTQHDVQEMNRILMDRLEL
AMKGSAIDGSLNDIFVGKMKSYIKCVNVSYESSREEDFWDIQLNVKGFSNLEASFKNYIE
IEMLDGENKYQAGDEHGYQDAKKGVVFRSFPPVLHLQLKRFEYDFMVDDMVKIDDLYEFP
DSIDLKPYLDEDLPSEVKSQNWTYKLHGVLVHQGSISNGHYYAMIKPEASSDSWLRFDDD
KVWKATHTQVFKENFGASELTSQEFARLSRADQNEYLIRRATSAYMLVYYRESELDSILP
KDNASIDSHIPKHIPTQIKAETEEKERVEKVREEASYYINVKCVSVDSYNAYSGFDLYPD
PTMPKYYDESLVKPESLPHVFKMKKEDKITKVYERVGVQLQYLAEGTQITEDEIDSLPFR
LLLVNHRNNHTNRTDTPIPPKLRDHTINAVYVKCYNRGFDEMVLFVEELRKDLFNVVSNI
SNKDKIEPLKFSFENVSKEIESSKLDIEKQKFHDIFDYSAHITIFLKYYDTASNNLYGLT
HVTVEKQAKIDSLTSYINSLLGFEEDNHLEYFEELSQLKIEPVDQLLSFEKHELSNGDIL
AVQSLSEEKKNVQEFYNFLLTRLHIKVSPFKAEKEEEDSDYVADNLDSEVQKSSVKPTDN
QTFDFWVSTQYSYDDLAKKIAQHLGPDVDAEYLRLFIVNYQGVRYPLKSSHHLSQFFSRL
VPLSQITNFEYEVLNIKLKEYENMRSIKVNWVTSLVLAQLYDLLIPKTGLVSDLIKKLIH
KAGVKEEVVHDMLVWTGQDHKYVDLVRFDRKIDTLPDNVDIYAGIFPAEVQILLEFDMIK
RFKEVPGNVNDILDESTKTELKLAQGSAKKLNMIPAFHFHRNSTYHHGIPFIFPVYPDEK
FARTAERLRKRLGVSPQAFSKIKIALADANDKGRYLNTESESLNLFDEILNCDASMSLAL
DHYDRSPKRGAAYDKGISIK
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atgacaccagattttgaggacaaagagaacctcaacttgggggccaaaggcgccgttccc
cccaatgccgacctgatctacgttgatctaatggaagaagacgatgaaagtgcggagcag
atagtgatagatgaggaggacgacgatgaagaagatgaagatgatcaggaaatggctgaa
gacactgaacctgtcactcgtcgagcaaccgcccctgatccaaggctgacagcaattcca
aaagcaaatgagtttgaaaagctagctaagcgcctcatgaaaccccttcctgattatcct
gtcgctgacgaaactcatcacgtttggactatagactcgtggtcgagtttacgtgagaat
aagattaggggtcctacgttcaagtgtggcggatacgagtggaatgtgctcttattccct
cgtggcaacaacaacactcacatctccatctaccttgagccccacaaaattcttgacgac
aagaatatgagggcggacgattggtacgtctgtgctcaattcgcattggatatctggaac
cccagctatccagagtgtcaccttcccagcggctcattccacagatttaacaagaatgaa
accgactgggggttttccacattcatcgatcttggccagttgaattcgactcgaaggttt
aacaatggccatgccatattggaaaagaacacccttaacatcactgcctatgtcaggatc
atagatgattcttccactggtgtgttatggcactcttttctcgattacgactccaaggct
agtactggctacgtcgggctcagtaatcagggtgcgacgtgctacttgaattcacttctt
cagtcatactacacaaccaagatctttcgcgacctagtttaccagatccccacggaaact
cacaaaaagggtcagtcagtctctctagagttgcagcgtattttctacctattactgact
tcctcagaagcagtgggaactttggagttgacaaagtcctttggatgggattcttctgaa
gcatttacacagcatgatgttcaagaaatgaaccgtatattaatggatagacttgagctg
gccatgaaaggaagtgccatcgatggttcgttgaacgatatatttgtgggcaagatgaaa
tcttacatcaagtgcgtaaatgtctcttatgaatcgtcaagagaagaagacttttgggat
attcaattgaacgtcaagggattctccaacttggaagcatcttttaagaactatatcgag
attgaaatgcttgatggagaaaataagtaccaagcaggcgatgaacacgggtaccaagat
gccaaaaagggagtcgttttccgatcattcccaccagttcttcatttgcaattgaagaga
ttcgagtatgactttatggtcgacgatatggtgaagattgacgatttgtacgagttcccc
gactcaattgacttgaagccatacttggatgaagatttgccttctgaagttaaatctcag
aactggacttacaagcttcatggtgttctagtacaccaaggaagcatttctaatggccac
tattatgccatgattaaacccgaagcctcctcagactcgtggcttcgattcgacgatgat
aaagtatggaaagcaactcatactcaggtattcaaggaaaactttggggctagtgagttg
acgtctcaagaattcgccaggctctccagagctgaccaaaacgaatatctcatccgccga
gctacatcggcttatatgttggtttactatcgagagtcggaattggattcaatattacca
aaagacaacgcctccattgatagtcacattccaaaacacattccaactcaaatcaaagct
gaaactgaagagaaagagcgcgtagagaaagtcagagaggaagcctcgtattacatcaat
gttaagtgtgtgtcagtggacagttacaatgcatactcaggctttgatttataccctgac
cccactatgccaaagtactacgatgagtcgttggtgaagcctgaatctttgccccacgta
ttcaaaatgaagaaagaagataagattaccaaagtatacgagagagttggggtgcaatta
cagtatcttgcagagggcacgcagattactgaagacgagatagactctcttccattccgc
ttacttcttgtgaaccaccgtaataatcatacaaacagaacggatactccaatcccgccc
aagcttcgagaccacacgattaatgcagtatatgtcaaatgttacaatcgtggatttgac
gagatggtgttgtttgtcgaggaattgagaaaggacctctttaatgtggtttccaacata
tcaaacaaagacaaaattgagcctctgaaattttcatttgaaaatgtgtccaaggaaatc
gaaagcagcaagttggacattgagaaacagaaatttcatgacatctttgattattcagcg
cacatcaccatcttcttgaaatactatgatactgcgtcgaataatttgtacgggttgact
catgtgactgtcgagaaacaggcaaaaatcgattcactcacttcttacattaattcactt
cttgggttcgaagaagacaaccatcttgaatactttgaagaattgtctcagttgaagatt
gaaccggtggaccagctgttgtcttttgagaaacatgagctcagtaatggtgacatactc
gccgttcaatctttgtcagaggaaaagaaaaacgtacaagaattttataactttttgctt
accagactccacatcaaagtgagtccgttcaaagctgaaaaagaagaggaagacagcgac
tacgtagctgataacctggatagcgaagttcaaaagtcgtctgtgaaacctactgataat
cagacttttgatttttgggtgtcaacccaatacagttacgatgacttagcaaagaagatt
gcacagcatttgggccctgatgttgatgctgaatacttgaggttgttcatcgtgaactac
cagggagtcagatacccattgaaatctagccatcatttgtcacaattcttttcgaggctg
gttccgctttcgcagatcactaatttcgagtatgaagtgcttaatatcaaacttaaggaa
tacgagaacatgcggtcgataaaggtaaattgggtaacttctttggtcctggcacagttg
tacgatttgttgatacctaagacaggtttagtatctgacctcattaagaaattgattcac
aaggcaggggtgaaggaggaggttgtacatgatatgttggtgtggacaggacaagatcac
aagtatgtcgatttggttcgatttgatcgcaagatcgacaccttaccggataacgttgac
atttacgcagggatctttccagcagaggttcagatattgttggagtttgacatgatcaaa
cggttcaaagaagtgccgggcaatgtcaatgacattttggatgaaagtacgaaaacagaa
ttgaagcttgcccaagggtcggccaagaaattgaatatgattcctgcttttcactttcac
agaaacagcacatatcatcatggtatcccatttattttcccagtctaccctgacgaaaag
tttgcccgaactgcagagcgattaaggaagcgtcttggggtaagtccgcaagcgttcagc
aagatcaagattgccttagctgatgcgaatgataagggtcgctatctaaacaccgagagt
gaatcattgaacttgtttgatgaaatattgaattgtgatgcgtcaatgtcgctagctctc
gatcactatgaccgatctcccaagagaggtgctgcttatgataagggcatttccatcaaa
taa

DBGET integrated database retrieval system