KEGG   Meyerozyma guilliermondii: PGUG_03558Help
Entry
PGUG_03558        CDS       T01150                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
pgu  Meyerozyma guilliermondii
Pathway
Sulfur metabolism
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pgu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEEGAPNKVGPNLHGLIGRKSGQVEGYSYTDANK
KKGVEWTEQNLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLVSATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaagggttctgagaaaaaaggtgctactctctttaagaccaga
tgcttgcaatgtcacaccgttgaggagggtgctcctaacaaggttggtcctaacttgcac
ggacttattggtagaaagtctggtcaagtcgaaggttactcttacactgatgccaacaag
aagaagggtgtcgagtggaccgaacagaacttgtccgattacttggagaacccaaagaag
tacattccaggtaccaagatggctttcggtggtttgaagaaggccaaggacagaaacgat
ttgattacctacttggtttcagccaccaagtag

DBGET integrated database retrieval system