KEGG   Meyerozyma guilliermondii: PGUG_03558Help
Entry
PGUG_03558        CDS       T01150                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
pgu  Meyerozyma guilliermondii
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF3365
Motif
Other DBs
NCBI-GeneID: 5125948
NCBI-ProteinID: XP_001484177
UniProt: A5DJV7
AA seq 110 aa AA seqDB search
MPAPYEKGSEKKGATLFKTRCLQCHTVEEGAPNKVGPNLHGLIGRKSGQVEGYSYTDANK
KKGVEWTEQNLSDYLENPKKYIPGTKMAFGGLKKAKDRNDLITYLVSATK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgccagctccatacgaaaagggttctgagaaaaaaggtgctactctctttaagaccaga
tgcttgcaatgtcacaccgttgaggagggtgctcctaacaaggttggtcctaacttgcac
ggacttattggtagaaagtctggtcaagtcgaaggttactcttacactgatgccaacaag
aagaagggtgtcgagtggaccgaacagaacttgtccgattacttggagaacccaaagaag
tacattccaggtaccaagatggctttcggtggtttgaagaaggccaaggacagaaacgat
ttgattacctacttggtttcagccaccaagtag

DBGET integrated database retrieval system