KEGG   Meyerozyma guilliermondii: PGUG_03560Help
Entry
PGUG_03560        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PGUG_03560
Peptidases [BR:pgu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PGUG_03560
Transcription machinery [BR:pgu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PGUG_03560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 516 aa AA seqDB search
MHSELMPDSQVDLYSSIGPCVHVDKVLASRAKENVLTTYRQAVKIVLLRPHGCRVIQKKD
GSEIAVTKLMDHKSRALRCSDCLSNGFHQTFVCLQCPHVGCINTKHNHAHRHYKLSHHSF
AIDAHTGLLFCFQCGDYVNHQDLELIRTRHIEGIPKLESLKIPEGSSDPDIKNNYTIPPV
AAVSGLKGFVNLGSTCFMSCILQTFIHNPLVKYQFFNNDLHYFNCDSMQEYHSANPNVTE
NNACITCSIDVIFRNFYTSTSIEGYGMTNLLMTAWYKNKSLAGFEEQDAHELWQFLLNEL
HSDHERSLQRSSQHESEQNMCQCITHSTFSGTLASSIQCQNCQETTETVDPMIDLSLEIG
RLKNKQKTANLYDCLDRFTSSEKLDVMYTCHHCGEKSEATKSLKIKKLAPVLSIQLKRFE
HNKSNDGSSKVETPVSIPIYLDISKYTSDEKATNIYELFAVVCHVGLVNTGHYIVVVKDG
EGRWLKFDDSVISLIAESEVSSMNGYLLFYISHKII
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagaactcatgccagatagccaggttgatctttattctagcattgggccttgt
gttcacgttgacaaggtgctcgcttctcgagccaaggagaatgtgcttacgacttacaga
caagcagtgaagattgtcctgctccgaccccatggatgtcgagttatccagaagaaggac
ggctctgagattgccgttacaaagttaatggaccataagtccagagcacttcgttgctct
gattgcctttccaatggctttcatcaaacatttgtatgcttacaatgtcctcatgttggt
tgtatcaatacaaagcataaccacgctcatcgacactacaaattgagccaccattccttt
gctattgatgcacatactggcctacttttctgcttccagtgcggagattatgtcaatcac
caagacttggagctgatacgaaccagacacatcgaaggcattcccaagctggaatcgctt
aaaataccagaaggatcctcagatccagatataaaaaataattataccattcctccggtt
gctgctgtgagcggactcaaaggattcgtcaatcttgggtccacatgtttcatgagttgc
attcttcaaacatttattcacaatccattggttaaatatcaattttttaacaacgattta
cactacttcaactgtgacagcatgcaagaatatcacagtgccaacccaaatgtgacagaa
aacaatgcatgtatcacttgcagcatagatgtcatattcagaaacttttacacatccacg
agcatcgaaggctacggaatgactaatttacttatgacagcatggtacaagaacaagtca
cttgcaggtttcgaagaacaagatgctcacgaactttggcaatttcttcttaatgaactc
cactcagaccacgaacggtcgctccagcgatcgtctcaacatgaatcagagcaaaacatg
tgccaatgcatcactcattcgactttttccggtactcttgccagttcaattcagtgccaa
aattgccaagaaaccaccgaaactgttgacccaatgatcgatctttcgttggaaatagga
agattgaaaaacaagcaaaagactgcaaacttgtacgactgtcttgatcgatttacctca
tcggagaaattggatgttatgtacacatgccatcattgcggcgaaaaatctgaggcaacg
aagagcttaaagattaaaaaattggcaccagtattatcgattcaacttaagcgattcgaa
cataataaatccaacgatggctcttcaaaagtggagacaccagttagcatcccaatctac
ttggacatttcaaagtacacatctgatgaaaaagcgacaaatatttatgagctcttcgcc
gttgtatgccatgttggactggtaaatacgggccactacatcgtcgttgttaaagacggc
gaaggtagatggttaaaatttgacgatagcgtcatatcattgattgcagaatcagaagta
agttccatgaatggatacttgttgttctacattagtcataaaattatttag

DBGET integrated database retrieval system