KEGG   Meyerozyma guilliermondii: PGUG_03560Help
Entry
PGUG_03560        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 516 aa AA seqDB search
MHSELMPDSQVDLYSSIGPCVHVDKVLASRAKENVLTTYRQAVKIVLLRPHGCRVIQKKD
GSEIAVTKLMDHKSRALRCSDCLSNGFHQTFVCLQCPHVGCINTKHNHAHRHYKLSHHSF
AIDAHTGLLFCFQCGDYVNHQDLELIRTRHIEGIPKLESLKIPEGSSDPDIKNNYTIPPV
AAVSGLKGFVNLGSTCFMSCILQTFIHNPLVKYQFFNNDLHYFNCDSMQEYHSANPNVTE
NNACITCSIDVIFRNFYTSTSIEGYGMTNLLMTAWYKNKSLAGFEEQDAHELWQFLLNEL
HSDHERSLQRSSQHESEQNMCQCITHSTFSGTLASSIQCQNCQETTETVDPMIDLSLEIG
RLKNKQKTANLYDCLDRFTSSEKLDVMYTCHHCGEKSEATKSLKIKKLAPVLSIQLKRFE
HNKSNDGSSKVETPVSIPIYLDISKYTSDEKATNIYELFAVVCHVGLVNTGHYIVVVKDG
EGRWLKFDDSVISLIAESEVSSMNGYLLFYISHKII
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgcattcagaactcatgccagatagccaggttgatctttattctagcattgggccttgt
gttcacgttgacaaggtgctcgcttctcgagccaaggagaatgtgcttacgacttacaga
caagcagtgaagattgtcctgctccgaccccatggatgtcgagttatccagaagaaggac
ggctctgagattgccgttacaaagttaatggaccataagtccagagcacttcgttgctct
gattgcctttccaatggctttcatcaaacatttgtatgcttacaatgtcctcatgttggt
tgtatcaatacaaagcataaccacgctcatcgacactacaaattgagccaccattccttt
gctattgatgcacatactggcctacttttctgcttccagtgcggagattatgtcaatcac
caagacttggagctgatacgaaccagacacatcgaaggcattcccaagctggaatcgctt
aaaataccagaaggatcctcagatccagatataaaaaataattataccattcctccggtt
gctgctgtgagcggactcaaaggattcgtcaatcttgggtccacatgtttcatgagttgc
attcttcaaacatttattcacaatccattggttaaatatcaattttttaacaacgattta
cactacttcaactgtgacagcatgcaagaatatcacagtgccaacccaaatgtgacagaa
aacaatgcatgtatcacttgcagcatagatgtcatattcagaaacttttacacatccacg
agcatcgaaggctacggaatgactaatttacttatgacagcatggtacaagaacaagtca
cttgcaggtttcgaagaacaagatgctcacgaactttggcaatttcttcttaatgaactc
cactcagaccacgaacggtcgctccagcgatcgtctcaacatgaatcagagcaaaacatg
tgccaatgcatcactcattcgactttttccggtactcttgccagttcaattcagtgccaa
aattgccaagaaaccaccgaaactgttgacccaatgatcgatctttcgttggaaatagga
agattgaaaaacaagcaaaagactgcaaacttgtacgactgtcttgatcgatttacctca
tcggagaaattggatgttatgtacacatgccatcattgcggcgaaaaatctgaggcaacg
aagagcttaaagattaaaaaattggcaccagtattatcgattcaacttaagcgattcgaa
cataataaatccaacgatggctcttcaaaagtggagacaccagttagcatcccaatctac
ttggacatttcaaagtacacatctgatgaaaaagcgacaaatatttatgagctcttcgcc
gttgtatgccatgttggactggtaaatacgggccactacatcgtcgttgttaaagacggc
gaaggtagatggttaaaatttgacgatagcgtcatatcattgattgcagaatcagaagta
agttccatgaatggatacttgttgttctacattagtcataaaattatttag

DBGET integrated database retrieval system