KEGG   Meyerozyma guilliermondii: PGUG_03566Help
Entry
PGUG_03566        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     PGUG_03566
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 506 aa AA seqDB search
MSGNNKGSTLESKSPIKITGDSKDASAKYGPGDIIPGCKVYAQKDGEIRLAEILQEHVRK
GRKVYYVHYQDFNKRLDEWIGVDKIDFSRALIAPEVKVDKKEDGKEGKNKALKSKTKNSK
TPGPGELVSASATPEIKNEDELDLDNLNVQGLKRPGEEVSREQEIKNLRTGGSMTQNHLD
VARVRNVNTVILGEHIIEPWYFSPYPIELTEEDEIYICDFTLSYFGSKKQFERFRTKCSM
KHPPGNEIYRDSKVSFWEIDGRRQRTWCRNLCLLLKLFLDHKTLYYDVDPFLFYVMTIKS
AQGHHVVGYFSKEKESADNYNVACILTLPCYQKKGYGKLLIQFSYMLSRVENKIGSPEKP
LSDLGLLSYRAYWTDTLVKLIVERNNPLLYKKNNPAPVADAKESSETPPPSRLAHNGSST
PTSEITIDEISSITCMTTTDILHTLTTLQILRYYKGQHIIVVTDQIMAMYDKLIKKVKEK
KKHELDPRKLQWQPPSFTANQLRFGW
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaacaacaagggttctacactagaatcgaagagcccaatcaaaatcacgggt
gactcgaaggacgcgagtgccaaatatgggcccggggacatcattccagggtgcaaagtg
tatgcccagaaagatggcgagattcgtttggcagaaattcttcaagaacatgtacgtaaa
ggacgcaaagtgtactacgtgcactatcaggacttcaacaagcgtttggatgagtggatt
ggtgtggataaaattgatttttcacgagcccttattgcacctgaggtcaaggtagataag
aaggaagacggaaaggagggtaaaaacaaagctctgaagtccaagacgaaaaactcaaag
acccctggtcctggtgaactggtgagtgcgagcgcgacgccagagatcaaaaatgaagat
gagttagatttggataacttaaatgttcaaggtttaaaacgacctggagaagaagtaagt
cgagagcaggaaatcaaaaacttacgaacaggtggttccatgactcaaaaccatctggat
gtggctcgtgttcgtaatgtgaacactgtgattcttggagagcacattatcgagccatgg
tacttctctccgtatccaatcgagcttacagaagaggacgaaatctacatttgtgatttc
acgttgtcgtatttcggctccaaaaaacagttcgagaggttcagaaccaaatgctcaatg
aagcatcctcccgggaacgagatctaccgagattcaaaagtcagcttttgggaaatcgat
gggcgcagacagagaacttggtgtagaaatctttgtttgctactgaaattatttttggat
cacaaaacactttactacgatgttgatcctttcttgttctatgttatgaccatcaaatcg
gcccaaggacaccatgtcgttggctatttctcaaaagaaaaagaaagcgcagacaactat
aacgtcgcctgtattctcacgttaccttgctaccaaaagaagggttatggtaagcttttg
attcagttttcttatatgctttccagagtggaaaacaaaattggttcgcctgaaaaaccc
ctttcagatttgggtttattgtcgtatcgtgcgtactggacagatacccttgtcaagctc
atagttgaaaggaacaatccgctgttgtacaagaagaataacccagcacctgtcgctgat
gctaaggagtcatctgaaacaccaccgccatccagactggctcacaatggctcgtcaact
ccaaccagtgaaatcactatcgacgagatatcctccattacctgtatgacaacgacagat
atactacacacactcaccacactccaaattcttcggtactacaagggacaacacataata
gttgtcaccgaccagatcatggcaatgtatgacaagttgatcaagaaagtgaaagagaag
aagaaacatgagttggaccctcgcaagttgcaatggcagccaccctcgttcactgcaaac
cagttacgttttggttggtag

DBGET integrated database retrieval system