KEGG   Meyerozyma guilliermondii: PGUG_03603Help
Entry
PGUG_03603        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
pgu  Meyerozyma guilliermondii
Brite
Enzymes [BR:pgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     PGUG_03603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 644 aa AA seqDB search
MSLITNRKRPRGLSESFDQQKARAAEVKDVLFDNNGNASNYNSSPGISSNHNLNLNLNID
LNNSNSDLSTRKNTDTLIYFIGNGTDMYENEGDSLLQQDFGDEEDYEEEDDDVVIIEERR
VATYDQPKARRNNSDSVIILDNDAFAAYNMFNVNQETKIAERPNGSKKQRTNSLPQLPQA
KCFYNKIPSNYIVLHPKMGNVKTNIIPHQLNLPPCDDKDGHYIIRVNDLFANRFTILKLL
GQGTFGKVVECYDKVNRETVAIKIIRNIPKYRDAAKIELRILSTLKMFDNENLNHCIHLR
ECFDYRGHVCIVTDLLKISLYDFLEKNCFISFPGSHIQAISKQLIRSVTFLHDLNLIHTD
LKPENILLHDDSFVKKPLVSSTIITSYLKLTNNNAADALKRKYPRMSRILKDPLIQIIDF
GSAIFNDEYHSSIVSTRHYRAPEIVLGIGWSFPCDMWSVGCILVEFVIGEPLFKTHDNLE
HLAMIEKVTGSRIDKSIVRLSKQNENECGLKYFTNEYMRDDDELDQDDDDDVIIDDETSL
DNSLSLIFPSNSTPSKFITSVNLLDRIDKFISGRIGLDINFDYSLSSNYKKNKHVINFGN
FTFWWFFIDLLRKLFVTNPHHRITASEAMEHPWFNLGIEDEGTV
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaattacaaaccggaagcgccccagaggtcttagtgagagtttcgaccaacaa
aaggcccgggcggctgaggtgaaggatgtcttgttcgacaataacggcaacgccagcaac
tataattcgtctcctggaatcagctccaaccacaacttgaacttgaacctcaacatcgac
ctaaacaactcgaattctgacctttccaccaggaaaaacaccgacaccctgatctacttt
atcgggaacggcaccgacatgtatgaaaacgagggtgactcgctcttacaacaggacttt
ggcgacgaagaagactacgaggaggaggacgacgacgtggtgatcatcgaagaacgccga
gttgccacatatgaccaacccaaggctcgccgaaacaactccgactcggttatcattttg
gacaacgatgcttttgcggcctacaacatgttcaacgttaaccaagaaaccaaaatcgct
gaacgacccaatggttcgaagaagcaaagaacaaactcacttccacaactcccacaagcc
aagtgcttctacaacaagattcccagtaattacattgtgctgcaccccaaaatgggcaat
gtaaaaaccaacatcattcctcaccaacttaacctcccaccatgcgacgacaaggacggt
cattacattatacgggtcaatgatctatttgctaatcgcttcaccatactcaagcttttg
ggccaaggaacctttggaaaggtagtggaatgttacgacaaggtgaatcgtgaaacggtt
gccatcaagatcattcgcaatataccgaagtatagagacgcggccaagatagagttgcgt
atactttcgacgttgaagatgtttgataacgaaaacttgaaccactgcattcacttgcgg
gaatgtttcgattatcgtggtcacgtttgtattgtgactgacttgctcaaaatttccttg
tatgattttttggaaaagaactgtttcatttcgtttcctggttcccacattcaagccatc
tccaaacaattgattcggtcggtgacatttcttcatgatctcaatttgattcataccgat
ttgaaaccggagaatatcttgttgcacgacgattcttttgtaaagaaaccacttgtgagt
tccaccatcattaccagttacctcaaattaaccaacaataacgctgcagatgctctgaaa
cgaaaataccctcgcatgtcacgaatactcaaagatccgttaattcagatcatagatttt
ggcagtgccattttcaacgatgagtatcattcatccatagtatcgacccgccattatagg
gcacccgaaattgtattgggaatcgggtggtcatttccctgtgacatgtggtctgtcgga
tgcatcttggtagagtttgtgattggtgagccattgtttaaaacacatgataatctagag
catttggccatgatcgagaaggtgactgggagtcgcatagataagtctattgtgaggctt
tccaagcaaaatgaaaacgagtgcggattaaagtactttacgaatgagtatatgagagac
gacgatgagttggaccaagatgatgatgacgatgtgattatagacgacgaaacctcgcta
gacaatagcttgagcttgatctttcccagcaacagtacaccatccaaatttattaccagt
gtgaacctgttggaccgcatagacaagttcatcagtggtcgaatagggcttgacattaat
ttcgactattcattgtcgagtaactacaagaagaacaagcatgtcattaattttggcaat
tttacattctggtggtttttcatcgacttgttaagaaagctctttgtgacgaatccgcac
catcgtattacggcttccgaggcgatggaacatccgtggttcaatttgggtatagaggat
gagggaacggtatag

  All links  
No link information was found.   
DBGET integrated database retrieval system