KEGG   Meyerozyma guilliermondii: PGUG_03840Help
Entry
PGUG_03840        CDS       T01150                                 

Definition
hypothetical protein
Organism
pgu  Meyerozyma guilliermondii
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MVPLMSLNNASSSSVSSRDKTLPPAPVPSSPPDILQAKTLKRKNFKKLSLEPGAIKPEQD
NKNNFKNDNLKNENLNLAHSELKPIPPSLRDKRDRIRPAPLLNLDKPVNPDDNTVDNDLM
NHFSGIKLNSHRTSNLHTSVPKKRQTVISSISPTKSATSSPREPQVLSFASSSPMATTSS
IKLNNDDLLTLRSLGSGNSGTVSKILHIPTQKTMAKKIIHIELKLVIQTQIIRELKIMHE
CRSPFIIDFYGAFIDTNNTIVICMEYCNCGSLDKIANICRQFPLPVVKKLAFAILSGLTY
LYTTHKILHRDIKPSNVLMTHKGEFKLCDFGVLRELTNSLAVADTFVGTSTYMSPERIQG
MNYGIKSDVWLMGLMLLELASGRPVWIDDDDSVLGPEGILDLLQRIVNETPPTIRNKVDP
KTGAPYDPDLVRFIDSCLVKDEAKRKLPWELLEQDLFLRGVAEGTFDKEVKAWAKGIRKS
HKDT
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggtaccacttatgagccttaataacgcgtcttcgtcatccgtcagttcacgagacaaa
acgcttcctccggcccctgttccgtcgtctccaccagacattctccaggccaagacattg
aagcggaaaaacttcaaaaagctctcgctagagcctggggccatcaaaccggaacaagac
aacaaaaacaatttcaaaaatgacaatcttaaaaatgagaatctcaacttggcacattcg
gaactcaaaccgattcccccgtctctcagagacaaacgagatcgtatccgtcctgctccg
cttctcaatctcgacaaaccagtaaacccggatgacaatacagtggataacgacctcatg
aaccatttttcaggcatcaaactcaacagtcaccgcacctccaatctgcataccagcgtt
cccaaaaagagacaaacggtgatttcgtcgatctcgcccaccaaatccgccacgtcgtcg
ccacgagaaccgcaggtgctcagttttgcatcgtcgtcgcccatggctaccacctcctcc
atcaagctcaacaacgacgatctcctcactctccggtctctcggtagcggaaactcgggc
acagtgtccaagatcttgcatattcccacccagaagaccatggctaagaaaatcattcat
attgagctgaaactggtgatccagacacaaatcatccgtgaactcaaaatcatgcacgag
tgccgttctcccttcattatcgacttctatggcgccttcatcgacaccaacaacaccatt
gtcatctgcatggaatattgcaactgtggctctttggacaagatcgccaatatctgtaga
caatttcctcttccagtggtcaagaaacttgcatttgcaattttatctggactcacctac
ctttacaccacccacaagattcttcaccgtgatatcaaaccaagcaatgtgttgatgact
cacaaaggtgagttcaagttgtgtgattttggagtgctgagagaattaaccaattcttta
gcggtagccgatacttttgtcggtacctcaacttatatgtctcccgagcggatccaaggt
atgaactacggaatcaagtctgatgtgtggctgatgggtcttatgttgttagagttggct
tctggacgtccagtgtggattgacgatgacgactcggtgctgggcccagaaggcattttg
gatcttttgcaaagaattgtcaacgaaacacctccaactatcaggaacaaggtggatccc
aaaactggggcaccgtacgacccggatcttgttcggtttatcgattcgtgtttggtgaag
gacgaggcaaaacgcaagcttccttgggaattgctcgagcaagatttatttttgcgagga
gtagctgaaggaacttttgataaagaagtcaaggcgtgggcaaaaggcattagaaagtca
cacaaggacacatag

DBGET integrated database retrieval system