KEGG   Meyerozyma guilliermondii: PGUG_03879Help
Entry
PGUG_03879        CDS       T01150                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
pgu  Meyerozyma guilliermondii
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 910 aa AA seqDB search
MPIEKDACETHISVREAAGAWVKAILQKPFLSNYYQGADYHYLLDRISRSIPRPCIKVAR
MSTPGYIYRFAWQAAACGVPVSAVASFRLSGNEIFISLFLYCSIFSQNNRGAHEVVNNMS
QFEDTPQAPGAMKLEDTSSRQTPELDGKHPLENHDGDTNGAENKRIKLEEHTESKNGPTK
AEPMSVALKENGGMVVVPPAQPQLFYVPLKTGLVYDVRMRYHAKIFTSYFEYIDPHPEDP
RRIYRIYKKLAETGLIHDTSLSGSDHLGPYMTKIPVREATAEEILEVHSKEHLLYIQSTE
KMSRDQLLEETEKGDSIYVNNDSYLSAKLSCGGAIEACKAVVEGTVKNSMAIVRPPGHHA
EPDTPGGFCLFSNVAVAAKNILKNYPESVRRIVIIDWDIHHGNGTQKAFYNDPRVLYISL
HRYENGRFYPGTKYGHYSNVGEGPGEGYSVNIPWNCPGKGDGDYVYAFNKIILPVINEFN
PDLLIVSSGFDAADGDIIGGCHVTPVGYGYMTHLLKGIARGNLAVILEGGYNLDSITNGA
LAVTKVLLGEPPENTISALPLSDTIETVDEVMKALAQYWKCMRIGMPKQSFEDVFDLSTN
TNAYKLTNIADTIRSHQANELFEKYNFVNLPIVTAATADTKSSYFTDMPSRKDDLILASP
DIYNAETLVVTIHDPHEIWANIEPNSGTIDGGSSVVLEHPMVQIMEKVKSELAESSEPSN
EKLGFMDIEIPSLALPSKPIGSLANPSVSTYSPTIFSQELLLYVWDNYITYFSNIKKIVF
VGFGDAYQAIVHLYSKRPPQEIKEVVKGTIAFAAKSPLKPLVSVMDESMVDWYYQNSVVF
TSHLNSCWTSTGSGRAADSADENKRPRRKFGRVLKSGSDNLWDVISDKFNEGIDFVLDSI
EDLSGTEESS
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaaaaagacgcatgcgagacgcatatatctgtcagagaagcagctggcgca
tgggtaaaggccatattgcaaaagccttttttgagtaactattaccagggagctgattac
cactatctactcgatcgtatctctcgttcaataccccgcccctgcatcaaagttgctcgc
atgtccacgccaggctatatttaccgtttcgcttggcaggcagcggcatgcggtgtaccg
gtgtccgctgtggcttccttcagattatccggaaatgagatcttcattagtttatttcta
tattgttcaattttctctcaaaacaatagaggtgcccacgaagtcgtgaacaacatgtct
caatttgaggacacaccccaggcaccaggtgccatgaaattggaggatacaagctcacga
caaactccagagctcgatgggaaacacccgttggaaaatcacgacggagacacgaatggc
gcagaaaacaagagaatcaagctagaagagcatacagaatccaaaaatggccccacaaaa
gcggagccgatgtcggtagccctgaaagaaaatgggggcatggtggtggtgccgccagca
caaccgcaacttttctacgtaccattgaaaaccgggttagtttacgacgtacgaatgaga
taccacgccaagatcttcacgtcgtactttgagtacattgatcctcacccggaagaccct
cgaagaatttatcgaatctacaaaaagttggccgaaaccggtttaattcacgatacttca
ttgtctggaagcgaccatttgggaccctacatgaccaaaattcccgtaagagaagccact
gctgaagagattctcgaagtgcattcaaaagagcatttgctgtatattcaatcgactgaa
aaaatgtcgcgagaccaattactcgaagaaacggaaaaaggtgactctatctacgtcaat
aacgactcctacttgtctgccaagctctcgtgcggaggagcaattgaggcttgtaaggca
gttgttgaaggaacagtgaaaaattcaatggctattgttcggccaccgggccatcatgct
gagccagatacccctggaggtttctgtttgttcagtaacgtagcggtggccgccaagaac
attctcaagaactaccctgagtctgtgcgaagaatagtgattatcgactgggatattcat
catggaaatggtacgcaaaaagcattctacaacgatcccagagttctctatatctcactt
catcgctacgaaaacggcagattttatccaggaacgaaatacggccattatagcaatgtt
ggtgagggtcctggtgaaggttactcggtaaatatcccctggaactgcccgggaaaagga
gatggagattacgtctatgcattcaacaaaatcatattacctgtgatcaacgagttcaac
ccggacttgttgattgtcagctcgggttttgacgctgctgatggtgatatcattggcgga
tgccatgtcactcctgtaggatacgggtatatgacccatttattgaaaggaattgcccga
ggaaaccttgcagtcatattggaaggaggctacaatttggattccatcacaaatggtgct
ctagccgtaaccaaagtgcttctaggagaacctccagagaacaccatttctgcgcttccg
ctgtctgacaccattgaaaccgttgacgaggtcatgaaggcattggcacaatactggaaa
tgcatgaggataggaatgcccaaacagtcctttgaagatgtctttgacctctccaccaat
accaatgcatacaagctcactaatatcgccgataccatccgatcgcaccaggccaacgag
ctctttgaaaagtacaattttgtcaacttgccaattgtcacagcagctaccgcagatacg
aagagttcctatttcacagatatgccttctcgcaaagacgatctcattcttgcaagtcct
gatatatataatgccgagacgttggttgtcaccattcacgatccacacgaaatctgggct
aatatcgaacccaattctggaaccattgacggaggctcttcggttgttcttgagcatcca
atggtgcaaataatggaaaaggtcaagtctgaattagcagaaagctcggaaccatctaat
gaaaaattgggtttcatggatatcgaaattccatccttggctcttccctcgaagcccatc
ggctctttggctaacccttctgtatcaacctacagccctaccattttctcacaggagttg
cttctctacgtttgggacaactacatcacttatttttcaaacatcaagaaaatcgttttc
gttggatttggcgatgcgtaccaagcaattgtccatctttattcgaaaaggccaccacaa
gaaatcaaagaggtcgttaaaggaaccatagcatttgcagcaaaatctccattgaagcca
ttggtatcagtcatggacgaatcaatggtagattggtattaccaaaattctgtggtgttc
accagccatctcaattcttgctggacttccactggttctggcagagctgcagactcggca
gacgaaaacaaaagaccaagaagaaagtttggtagggtcttgaagtcaggaagtgataac
ttgtgggatgtcattagtgacaagttcaacgaaggaatagactttgtcttggattctata
gaggacttgagtgggacggaggagtcttcgtag

DBGET integrated database retrieval system