KEGG   Meyerozyma guilliermondii: PGUG_04003Help
Entry
PGUG_04003        CDS       T01150                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
pgu  Meyerozyma guilliermondii
Pathway
pgu00511  Other glycan degradation
pgu00513  Various types of N-glycan biosynthesis
pgu00520  Amino sugar and nucleotide sugar metabolism
pgu00531  Glycosaminoglycan degradation
pgu00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pgu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PGUG_04003
  Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    PGUG_04003
   00531 Glycosaminoglycan degradation
    PGUG_04003
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    PGUG_04003
   00604 Glycosphingolipid biosynthesis - ganglio series
    PGUG_04003
   00511 Other glycan degradation
    PGUG_04003
Enzymes [BR:pgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PGUG_04003
Chaperones and folding catalysts [BR:pgu03110]
 Intramolecular chaperones
  Others
   PGUG_04003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 5125568
NCBI-ProteinID: XP_001483274
UniProt: A5DL52
AA seq 573 aa AA seqDB search
MFCSYALKSQFLTSPLFRTNYLTSFLITMRYLIFALYAGVILAAVGLLPAPKYVEKVGNG
HLKLSSACYLNSNVLDSIVLQGFDRMVSAIIDQKLTLNALPCVFNVYIEDADADLQMGVD
ESYEVKVKPQTSSIEISSKTRWGILHSFTTIQQLAAAGLFIQELHIKDKPLYPHRGLMID
SARNYLTVNSILEQIDIMALSKMNTLHWHLVDTQSWPIVLESHPEMALDAYSSQEVYTRA
DIQAIVSYGRQRAIRIIPEIDMPGHARAGWRRNDAELVICGDTDWEKQSTAVEPPPGQLN
LILNKTYDVVKEVYDEVSLAFSDNLFHVGSDEVSVGCYNSSLSIRTWLESHSKRGFLGLI
DHWLDEALPIFKNKKARRLIMWEDVLLSSVNASNLPKDVILQSWREHTNIQQLASRGYDV
IISSSSFLYLDCGVGTFFTNDIRYVENVTNYNWNYNGRDSWCGPYKTWQRIYSMNITGSL
TETEKSHILGYEAPLWSEQVDSNILTQKLWPRAAALAELSWSGNLNEKGQLRLEDFGQRL
LAFREYLVSLGHHPTPVAPKYCLKNPGACTVAA
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgttttgttcatatgctctcaaatcgcagtttcttacgtcacctttgtttcgcacaaat
tatcttacatcgtttctcattacaatgcgatatcttatctttgcactttatgctggggta
attcttgcagcggtgggtcttcttcctgctcccaaatacgtggaaaaagtaggaaatgga
cacttaaagttgtcttcagcctgttatttgaattctaatgttcttgattctattgttctt
caagggtttgaccgtatggtgtctgcgataattgaccagaaactaaccctaaatgccctg
ccgtgtgtattcaatgtttatattgaagatgctgatgctgatcttcaaatgggagtagat
gaatcatacgaggtgaaagtaaagccacaaacatcaagtattgaaattagcagtaaaacc
agatggggaatcctacacagttttacaacaatacaacaattggcggccgctggtttgttt
atacaagagttgcacatcaaggacaaaccactctacccacatcgaggccttatgatagat
agtgcccgaaattacttgacggtcaattctatactcgaacagatcgatatcatggcactt
tccaaaatgaacactcttcattggcaccttgtggatacccagtcgtggcccatagtactt
gaatctcacccagagatggctctagatgcatactctagtcaggaagtttacactcgagct
gatattcaagctatagtttcatatggtcgccaaagagccatcagaataattcctgagatc
gacatgccaggccatgctagagcaggatggagaagaaacgatgctgagttggtgatttgt
ggtgatactgactgggaaaagcagtcaactgcagtagaaccaccgcctggtcaattgaat
ttgatcttgaacaaaacctatgatgtggttaaggaagtgtatgatgaagtttcactggca
ttttctgataatctttttcatgtcggttccgatgaggtgtctgttgggtgctataactca
tctttgtcaattagaacatggcttgagagtcacagcaaaagagggtttctgggtttgata
gaccattggcttgatgaagcgttacccattttcaaaaataaaaaagccagaaggcttatt
atgtgggaagacgttttactttcttctgtcaatgcatctaacttgcccaaagacgttatt
ttgcagtcttggagagaacacactaatatccagcaattagcctctcgtggctatgatgta
ataatttcgtcttcctcgttcttatatctcgattgtggagttggaactttcttcacaaac
gacattaggtatgtcgaaaacgtcacaaattacaactggaactataatggaagagactca
tggtgtggtccctacaagacatggcagcggatctactccatgaacataactggttcgttg
acggaaactgaaaaaagtcatatcttgggatatgaagctccactttggtctgagcaagta
gacagtaatatcttgacccagaaactatggccccgagctgctgcactagcagaactctcc
tggagtggaaacttgaacgaaaagggccaattgcgtctagaagactttggacaacgactt
ctcgcatttcgagaatatttggtgagtcttggtcatcatccaacaccagtggctccaaag
tactgcttgaaaaatcctggggcatgtaccgtagctgcatag

DBGET integrated database retrieval system